Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T29 Olfactory Receptor

Gene Symbol OR2T291 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases HsOR1.5.44
External Ids HGNC: 31253   GeneBank: AB065613, NM_001004694   
Build #39 labels
Chromosomal location 1:248,558,547-248,559,473 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T5 99.35% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T4 85% 305
Dog OR2T4D 85% 308
Dog OR2T4C 85% 305
Dog OR2T4B 83% 305
Chimp CONTIG4776.2-1784 96% 309
Chimp CONTIG1126.46-6307 91% 305
Chimp CONTIG1126.55-3372 88% 311
Mouse Or2t29 82% 303
Rat Or2t29 81% 303
Cow OR2T29 85% 304
Cow OR2T4 83% 308
Cow OR2T29C 82% 306
Cow OR2T55 82% 305

Expression evidences

Source Accession
mRNA BC140915

Sequence information

Nucleotide sequence ATGGCCAACCACACTGGAAGGTTGGATTTCATCCTCATGGGACTCTTCAGACAATCCAAA
CATCCAGCTCTACTTAGTGTGGTCATCTTTGTGGTTTTCCTGAAGGCGTTGTCTGGAAAT
GCTGTCCTGATCCTTCTGATACACTGTGACGCCCACCTCCACAGCCCCATGTACTTTTTC
ATCAGTCAATTGTCTCTCATGGACATGGCGTACATTTCTGTCACTGTGCCCAAGATGCTC
CTGGACCAGGTCATGGGTGTGAATAAGGTCTCAGCCCCTGAGTGTGGGATGCAGATGTTC
CTCTATCTGACACTAGCAGGTTCGGAATTTTTCCTTCTAGCCACCATGGCCTATGACCGC
TACGTGGCCATCTGCCATCCTCTCCGTTACCCTGTCCTCATGAACCATAGGGTCTGTCTT
TTCCTGGCATCGGGCTGCTGGTTCCTGGGCTCAGTGGATGGCTTCATGCTCACTCCCATC
ACCATGAGCTTCCCCTTCTGCAGATCCTGGGAGATTCATCATTTCTTCTGTGAAGTCCCT
GCTGTAACGATCCTGTCCTGCTCAGACACCTCACTCTATGAGACCCTCATGTACCTATGC
TGTGTCCTCATGCTCCTCATCCCTGTGACGATCATTTCAAGCTCCTATTTACTCATCCTC
CTCACCGTCCACAGGATGAACTCAGCAGAGGGCCGGAAAAAGGCCTTTGCCACCTGCTCC
TCCCACCTGACTGTGGTCATCCTCTTCTATGGGGCTGCCGTCTACACCTACATGCTCCCC
AGCTCCTACCACACCCCTGAGAAGGACATGATGGTATCTGTCTTCTATACCATCCTCACT
CCGGTGCTGAACCCTTTAATCTATAGTCTTAGGAATAAGGATGTCATGGGGGCTCTGAAG
AAAATGTTAACTGTGAGATTCGTCCTT
Conceptual translation MANHTGRLDFILMGLFRQSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLHSPMYFF
ISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLATMAYDR
YVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHHFFCEVP
AVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKKAFATCS
SHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK
KMLTVRFVL

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,646,428 248,728,407 Inversion Variation_59670 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,703,193 248,795,305 CopyNumber Variation_75000 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q24R % Freq CORP
1 Q 92.17 0.098
2 R 7.83 0.098

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T29.aApr07-unspliced main_exon 3UTR chr1 248,558,544 248,558,547 -
CDS chr1 248,558,547 248,559,473 -