Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T3 Olfactory Receptor

Gene Symbol OR2T31 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score
Aliases HsOR1.5.42, ORL3040
External Ids HGNC: 14727   GeneBank: AB065612, NM_001005495   ORDB: ORL3040   
Build #39 labels OR2T3
Chromosomal location 1:248,473,351-248,474,304 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T34 98.11% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T4D 69% 302
Chimp CONTIG1126.52-3821 97% 321
Mouse Or2t29 66% 310
Rat Or2t29 64% 310
Cow OR2T3 82% 318
Cow OR2T3B 80% 318

Expression evidences

Source Accession
mRNA BC136916

Sequence information

Nucleotide sequence ATGTGCTCAGGGAATCAGACTTCTCAGAATCAAACAGCAAGCACTGATTTCACCCTCACG
GGACTCTTTGCTGAGAGCAAGCATGCTGCCCTCCTCTACACCGTGACCTTCCTTCTTTTC
TTGATGGCCCTCACTGGGAATGCCCTCCTCATCCTCCTCATCCACTCAGAGCCCCGCCTC
CACACCCCCATGTACTTCTTCATCAGCCAGCTCGCGCTCATGGATCTCATGTACCTATGC
GTGACTGTGCCCAAGATGCTTGTGGGCCAGGTCACTGGAGATGATACCATTTCCCCGTCA
GGCTGTGGGATCCAGATGTTCTTCTACCTGACCCTGGCTGGAGCTGAGGTTTTCCTCCTG
GCTGCCATGGCCTATGACCGATATGCTGCTGTTTGCAGACCTCTCCATTACCCACTGCTG
ATGAACCAGAGGGTGTGCCAGCTCCTGGTGTCAGCCTGCTGGGTTTTGGGAATGGTTGAT
GGTTTGTTGCTCACCCCCATTACCATGAGCTTCCCCTTTTGCCAGTCTAGGAAAATCCTG
AGTTTTTTCTGTGAGACTCCTGCCCTGCTGAAGCTCTCCTGCTCTGACGTCTCCCTCTAT
AAGACGCTCATGTACCTGTGCTGCATCCTCATGCTTCTCGCCCCCATCATGGTCATCTCC
AGCTCATACACCCTCATCCTGCATCTCATCCACAGGATGAATTCTGCCGCCGGCCACAGG
AAGGCCTTGGCCACCTGCTCCTCCCACATGATCATAGTGCTGCTGCTCTTCGGTGCTTCC
TTCTACACCTACATGCTCCCGAGTTCCTACCACACAGCTGAGCAGGACATGATGGTGTCT
GCCTTTTACACCATCTTCACTCCTGTGCTGAACCCCCTCATTTACAGTCTCCGCAACAAA
GATGTCACCAGGGCTCTGAGGAGCATGATGCAGTCAAGAATGAACCAAGAAAAG
Conceptual translation MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRL
HTPMYFFISQLALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFYLTLAGAEVFLL
AAMAYDRYAAVCRPLHYPLLMNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKIL
SFFCETPALLKLSCSDVSLYKTLMYLCCILMLLAPIMVISSSYTLILHLIHRMNSAAGHR
KALATCSSHMIIVLLLFGASFYTYMLPSSYHTAEQDMMVSAFYTIFTPVLNPLIYSLRNK
DVTRALRSMMQSRMNQEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A A/T 1000GP (YRI)
1 248,474,061 248,474,061 SYN C/T A/A 1000GP (CEU)
1 248,637,262 248,637,262 NS T/C M/T rs1770110 (DbSNP)
1 248,637,291 248,637,291 NS G/A A/T rs1770109 (DbSNP)
1 248,637,367 248,637,367 NS G/A R/H rs1770108 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,610,257 248,646,763 CopyNumber Variation_6817 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T202M M204T A214T % Freq CORP
1 T M A 95.39 0.144
2 T M T 1.92 0.144
3 T T T 1.23 0.144
4 T T A 0.61 0.144
5 M T T 0.61 0.144
6 M T A 0.15 0.144
7 M M A 0.08 0.144

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T3.aApr07-unspliced main_exon CDS chr1 248,473,351 248,474,304 +
3UTR chr1 248,474,304 248,474,307 +