Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T34 Olfactory Receptor

Gene Symbol OR2T341 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR1-63, HsOR1.5.45
External Ids HGNC: 31256   GeneBank: AB065645, AF399612, BK004477, NM_001001821   
Build #39 labels
Chromosomal location 1:248,573,804-248,574,757 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T3 98.11% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T4D 68% 302
Mouse Or2t29 65% 310
Rat Or2t29 63% 310
Cow OR2T3 81% 318
Orang OR2T3 96% 318
Horse OR2T79 67% 304
Chimp OR2T3BP 95% 321
Chimp OR2T3P 96% 318

Expression evidences

Source Accession
mRNA BC136926

Sequence information

Nucleotide sequence ATGTGCTCAGGGAATCAGACTTCTCAGAATCAAACAGCAAGCACTGATTTCACCCTCACG
GGACTCTTTGCTGAGAGCAAGCATGCTGCCCTCCTCTACACCGTGACCTTCCTTCTTTTC
TTGATGGCCCTCACTGGGAATGCCCTCCTCATCCTCCTCATCCACTCAGAGCCCCGCCTC
CACACCCCCATGTACTTCTTCATCAGCCAGCTCGCGCTCATGGATCTCATGTACCTATGC
GTGACTGTGCCCAAGATGCTTGTGGGCCAGGTCACTGGAGATGATACCATTTCCCCGTCA
GGCTGTGGGATCCAGATGTTCTTCCACCTGACCCTGGCTGGAGCTGAGGTTTTCCTCCTG
GCTGCCATGGCCTATGACCGATATGCTGCTGTTTGCAGACCTCTCCATTACCCACTGCTG
ATGAACCAGAGGGTGTGCCAGCTCCTGGTGTCAGCCTGCTGGGTTTTGGGAATGGTTGAT
GGTTTGTTGCTCACCCCCATTACCATGAGCTTCCCCTTTTGCCAGTCTAGGAAAATCCTG
AGTTTTTTCTGTGAGACTCCTGCCCTGCTGAAGCTCTCCTGCTCTGACGTCTCCCTCTAT
AAGATGCTCACGTACCTGTGCTGCATCCTCATGCTTCTCACCCCCATCATGGTCATCTCC
AGCTCATACACCCTCATCCTGCATCTCATCCACAGGATGAATTCTGCCGCCGGCCGCAGG
AAGGCCTTGGCCACCTGCTCCTCCCACATGATCATAGTGCTGCTGCTCTTCGGTGCTTCC
TTCTACACCTACATGCTCCGGAGTTCCTACCACACAGCTGAGCAGGACATGATGGTGTCT
GCCTTTTACACCATCTTCACTCCTGTGCTGAACCCCCTCATTTACAGTCTCCGCAACAAA
GATGTCACCAGGGCTCTGAGGAGCATGATGCAGTCAAGAATGAACCAAGAAAAG
Conceptual translation MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRL
HTPMYFFISQLALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFHLTLAGAEVFLL
AAMAYDRYAAVCRPLHYPLLMNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKIL
SFFCETPALLKLSCSDVSLYKMLTYLCCILMLLTPIMVISSSYTLILHLIHRMNSAAGRR
KALATCSSHMIIVLLLFGASFYTYMLRSSYHTAEQDMMVSAFYTIFTPVLNPLIYSLRNK
DVTRALRSMMQSRMNQEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,737,343 248,737,343 NS C/T R/H rs61833441 (DbSNP)
1 248,737,348 248,737,348 SYN A/G A/A rs61833442 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 63 (Hasin)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,703,193 248,795,305 CopyNumber Variation_75000 (DGV)
1 248,727,899 248,808,428 CopyNumber Variation_38963 (DGV)
1 248,727,928 248,796,682 CopyNumber Variation_6818 (DGV)
1 248,729,106 248,795,518 CopyNumber Variation_66541 (DGV)
1 248,732,055 248,795,305 CopyNumber Variation_74999 (DGV)
1 248,738,015 248,795,518 CopyNumber Variation_66540 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M202T % Freq CORP
1 M 92.24 0.074
2 T 7.76 0.074

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T34.aApr07-unspliced main_exon 3UTR chr1 248,573,801 248,573,804 -
CDS chr1 248,573,804 248,574,757 -