Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T35 Olfactory Receptor

Gene Symbol OR2T351 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR1-66, HsOR1.5.48
External Ids HGNC: 31257   GeneBank: AB065644, BK004475, NM_001001827   
Build #39 labels
Chromosomal location 1:248,638,290-248,639,258 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T2 99.38% 322

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T2 89% 321
Chimp CONTIG1126.51-19124 98% 317
Mouse Or2t35 83% 321
Rat Or2t35 86% 321
Cow OR2T2 87% 321

Expression evidences

Source Accession
mRNA AB528813

Sequence information

Nucleotide sequence ATGGGCATGGAGGGTCTTCTCCAGAACTCCACTAACTTCGTCCTCACAGGCCTCATCACC
CATCCTGCCTTCCCCGGGCTTCTCTTTGCAGTAGTCTTCTCCATCTTTGTGGTGGCTATA
ACAGCCAACTTGGTCATGATTCTGCTCATCCACATGGACTCCCGCCTCCACACACCCATG
TACTTCTTGCTCAGCCAGCTCTCCATCATGGATACCATCTACATCTGTATCACTGTCCCC
AAGATGCTCCAGGACCTCCTGTCCAAGGACAAGACCATTTCCTTCCTGGGCTGTGCAGTT
CAAATCTTCTACCTGACCCTGATTGGAGGGGAATTCTTCCTGCTGGGTCTCATGGCCTAT
GACCGCTATGTGGCTGTGTGCAACCCTCTACGGTACCCTCTCCTCATGAACCGCAGGGTT
TGCTTATTCATGGTGGTCGGCTCCTGGGTTGGTGGTTCCTTGGATGGGTTCATGCTGACT
CCTGTCACTATGAGTTTCCCCTTCTGTAGATCCCGAGAGATCAATCACTTTTTCTGTGAG
ATCCCAGCCGTGCTGAAGTTGTCTTGCACAGACACGTCACTCTATGAGACCCTGATGTAT
GCCTGCTGCGTGCTGATGCTGCTTATCCCTCTATCTGTCATCTCTGTGTCCTACACGCAC
ATCCTCCTGACTGTCCACAGGATGAACTCTGCTGAGGGCCGGCGCAAAGCCTTTGCTACG
TGTTCCTCCCACATTATGGTGGTGAGCGTTTTCTACGGGGCAGCCTTCTACACCAACGTG
CTGCCCCACTCCTACCACACTCCAGAGAAAGATAAAGTGGTGTCTGCCTTCTACACCATC
CTCACCCCCATGCTCAACCCACTCATCTACAGCTTGAGGAATAAAGATGTGGCTGCAGCT
CTGAGGAAAGTACTAGGGAGATGTGGTTCCTCCCAGAGCATCAGGGTGGCGACTGTGATC
AGGAAGGGC
Conceptual translation MEGLLQNSTNFVLTGLITHPAFPGLLFAVVFSIFVVAITANLVMILLIHMDSRLHTPMYF
LLSQLSIMDTIYICITVPKMLQDLLSKDKTISFLGCAVQIFYLTLIGGEFFLLGLMAYDR
YVAVCNPLRYPLLMNRRVCLFMVVGSWVGGSLDGFMLTPVTMSFPFCRSREINHFFCEIP
AVLKLSCTDTSLYETLMYACCVLMLLIPLSVISVSYTHILLTVHRMNSAEGRRKAFATCS
SHIMVVSVFYGAAFYTNVLPHSYHTPEKDKVVSAFYTILTPMLNPLIYSLRNKDVAAALR
KVLGRCGSSQSIRVATVIRKG

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber, Deletion 28 (Hasin)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,727,899 248,808,428 CopyNumber Variation_38963 (DGV)
1 248,799,314 248,802,543 CopyNumber Variation_30468 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G323D % Freq CORP
1 D 74.73 0.132
2 G 25.27 0.132

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T35.aApr07-unspliced main_exon 3UTR chr1 248,638,287 248,638,290 -
CDS chr1 248,638,290 248,639,258 -