Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T5 Olfactory Receptor

Gene Symbol OR2T51 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score
Aliases OR1-62, HsOR1.5.43, ORL3013
External Ids HGNC: 15017   GeneBank: BK004465, NM_001004697   ORDB: ORL3013   
Build #39 labels OR2T5
Chromosomal location 1:248,488,607-248,489,533 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T29 99.35% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T4D 84% 308
Dog OR2T4C 85% 305
Dog OR2T4 85% 305
Dog OR2T4B 83% 305
Mouse Or2t29 81% 303
Rat Or2t29 81% 303
Cow OR2T29 85% 304
Cow OR2T4 82% 308
Cow OR2T55 82% 305
Orang OR2T4 91% 305
Orang OR2T4F 89% 305
Horse OR2T4 84% 307
Horse OR2T79 82% 304
Horse OR2T80 81% 304
Chimp OR2T29 95% 309

Expression evidences

Source Accession
mRNA BC140747

Sequence information

Nucleotide sequence ATGGCCAACCACACTGGAAAGTTGGATTTCATCCTCATGGGACTCTTCAGACGATCCAAA
CATCCAGCTCTACTTAGTGTGGTCATCTTTGTGGTTTTCCTGAAGGCGTTGTCTGGAAAT
GCTGTCCTGATCCTTCTGATACACTGTGACGCCCACCTCCACAGCCCCATGTACTTTTTC
ATCAGTCAATTGTCTCTCATGGACATGGCGTACATTTCTGTCACTGTGCCCAAGATGCTC
CTGGACCAGGTCATGGGTGTGAATAAGGTCTCAGCCCCTGAGTGTGGGATGCAGATGTTC
CTCTATCTGACACTAGCAGGTTCGGAATTTTTCCTTCTAGCCACCATGGCCTATGACCGC
TACGTGGCCATCTGCCATCCTCTCCGTTACCCTGTCCTCATGAACCATAGGGTCTGTCTT
TTCCTGGCATCGGGCTGCTGGTTCCTGGGCTCAGTGGATGGCTTCATGCTCACTCCCATC
ACCATGAGCTTCCCCTTCTGCAGATCCTGGGAGATTCATCATTTCTTCTGTGAAGTCCCT
GCTGTAACGATCCTGTCCTGCTCAGACACCTCACTCTATGAGACCCTCATGTACCTATGC
TGTGTCCTCATGCTCCTCATCCCTGTGACGATCATTTCAAGCTCCTATTTACTCATCCTC
CTCACCGTCCACAGGATGAACTCAGCAGAGGGCCGGAAAAAGGCCTTTGCCACCTGCTCC
TCCCACCTGACTGTGGTCATCCTCTTCTATGGGGCTGCCGTCTACACCTACATGCTCCCC
AGCTCCTACCACACCCCTGAGAAGGACATGATGGTATCTGTCTTCTATACCATCCTCACT
CCGGTGCTGAACCCTTTAATCTATAGTCTTAGGAATAAGGATGTCATGGGGGCTCTGAAG
AAAATGTTAACTGTGAGATTCGTCCTT
Conceptual translation MANHTGKLDFILMGLFRRSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLHSPMYFF
ISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLATMAYDR
YVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHHFFCEVP
AVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKKAFATCS
SHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK
KMLTVRFVL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 nonsense SNP C/T R/* 1000GP (YRI)
1 248,488,658 248,488,658 nonsense SNP C/T R/* 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,646,428 248,728,407 Inversion Variation_59670 (DGV)
1 248,646,734 248,656,766 CopyNumber Variation_74995 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K13R R24* % Freq CORP
1 K R 63.06 0.098
2 R R 24.35 0.098
3 R * 7.37 1.200
4 K * 5.22 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T5.aApr07-unspliced main_exon 5UTR chr1 248,488,589 248,488,607 +
CDS chr1 248,488,607 248,489,533 +
3UTR chr1 248,489,533 248,489,536 +