Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T6 Olfactory Receptor

Gene Symbol OR2T61 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases HsOR1.5.38
External Ids HGNC: 15018   GeneBank: AF399481, NM_001005471   
Build #39 labels OR2T6P, OR2T9
Chromosomal location 1:248,387,609-248,388,532 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T1 72.79% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T6 82% 308
Chimp CONTIG1126.51-7507 65% 308
Chimp CONTIG6443.3-1119 64% 302
Chimp CONTIG1126.51-19124 64% 297
Mouse Or2t6 82% 305
Rat Or2t6 81% 305
Cow OR2T6 84% 308

Expression evidences

Source Accession
GNF Atlas2 gnf1h10656_at

Sequence information

Nucleotide sequence ATGAATGAAAACAATGAAACCTTGACCAGAGGCTTTACCCTCATGGGGCTCTTCACTCAC
AATAAATGCTCAGGATTCTTTTTCGGTGTCATTTGTGCCGTCTTCTTCATGGCCATGATA
GCTAATGGGGTCATGATCTTCCTGATTAACATAGACCCTCATCTCCACACCCCCATGTAC
TTCCTCCTCAGCCACCTCTCCGTCATTGACACATTATACATCTCCACCATTGTGCCCAAG
ATGCTGGTAGATTATCTCATGGGCGAGGGGACCATCTCTTTCATCGCCTGCACTGCTCAG
TGCTTTCTCTACATGGGCTTTATGGGGGCTGAATTCTTCCTGCTGGGGCTCATGGCCTAT
GACCGCTACGTGGCCATCTGCAACCCACTGCGCTATCCTGTCCTCATCAGCTGGCGGGTC
TGCTGGATGATCCTGGCCAGCTCTTGGTTCGGTGGGGCTTTGGACAGTTTTCTCCTCACC
CCCATTACCATGAGTCTCCCGTTCTGTGCCTCTCACCAAATCAATCACTTTTTCTGTGAG
GCACCCACCATGCTGAGGCTGGCCTGTGGGGACAAAACCACCTATGAAACAGTGATGTAT
GTGTGCTGCGTTGCAATGCTGCTGATCCCCTTCTCGGTGGTGACTGCATCCTACACCAGG
ATTCTCATCACAGTGCATCAGATGACATCGGCTGAAGGGAGGAAGAAGGCCTTTGCCACC
TGCTCTTCACACATGATGGTGGTGACATTGTTCTATGGGGCTGCCTTGTATACGTATACG
CTTCCCCAATCTTACCACACCCCAATCAAAGATAAGGTCTTCTCTGCCTTTTATACCATC
CTCACACCCTTATTAAACCCTCTCATCTACAGTCTGAGGAACAGGGATGTGATGGGTGCC
TTGAAGAGAGTTGTGGCAAGATGT
Conceptual translation MNENNETLTRGFTLMGLFTHNKCSGFFFGVICAVFFMAMIANGVMIFLINIDPHLHTPMY
FLLSHLSVIDTLYISTIVPKMLVDYLMGEGTISFIACTAQCFLYMGFMGAEFFLLGLMAY
DRYVAICNPLRYPVLISWRVCWMILASSWFGGALDSFLLTPITMSLPFCASHQINHFFCE
APTMLRLACGDKTTYETVMYVCCVAMLLIPFSVVTASYTRILITVHQMTSAEGRKKAFAT
CSSHMMVVTLFYGAALYTYTLPQSYHTPIKDKVFSAFYTILTPLLNPLIYSLRNRDVMGA
LKRVVARC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A E/K 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/A G/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 248,387,669 248,387,669 NS A/G N/D 1000GP (CEU, CHBJPT)
1 248,387,675 248,387,675 NS T/G C/G 1000GP (CEU, CHBJPT)
1 248,387,902 248,387,902 SYN T/C T/T 1000GP (CEU, CHBJPT)
1 248,388,181 248,388,181 NS C/A D/E 1000GP (CHBJPT)
1 248,388,259 248,388,259 SYN C/T S/S 1000GP (CEU, CHBJPT)
1 248,388,335 248,388,335 NS T/G S/A 1000GP (CEU, CHBJPT)
1 248,550,916 248,550,916 NS A/G K/E rs60632569 (DbSNP)
1 248,550,942 248,550,942 SYN A/C G/G rs60321142 (DbSNP)
1 248,550,970 248,550,970 NS A/G N/D rs7417616 (DbSNP)
1 248,550,976 248,550,976 NS G/T G/C rs6587467 (DbSNP)
1 248,550,993 248,550,993 SYN C/T F/F rs61736237 (DbSNP)
1 248,551,009 248,551,009 NS A/G I/V rs41308164 (DbSNP)
1 248,551,079 248,551,079 NS A/C N/T rs6693032 (DbSNP)
1 248,551,128 248,551,128 SYN C/T Y/Y rs61736241 (DbSNP)
1 248,551,146 248,551,146 SYN C/G P/P rs72766981 (DbSNP)
1 248,551,164 248,551,164 SYN C/T Y/Y rs61736242 (DbSNP)
1 248,551,174 248,551,174 NS A/G K/E rs61736246 (DbSNP)
1 248,551,194 248,551,194 SYN C/T I/I rs6693133 (DbSNP)
1 248,551,203 248,551,203 SYN C/T T/T rs6700947 (DbSNP)
1 248,551,204 248,551,204 NS A/G T/A rs6683656 (DbSNP)
1 248,551,319 248,551,319 NS T/G I/S rs2226010 (DbSNP)
1 248,551,385 248,551,385 NS C/T P/L rs6701129 (DbSNP)
1 248,551,466 248,551,465 Ins(1) -/G rs34365091 (DbSNP)
1 248,551,484 248,551,484 NS C/A T/K rs4454573 (DbSNP)
1 248,551,560 248,551,560 SYN C/T S/S rs954474 (DbSNP)
1 248,551,598 248,551,598 NS C/T S/L rs61736247 (DbSNP)
1 248,551,636 248,551,636 NS G/T A/S rs954475 (DbSNP)
1 248,551,727 248,551,727 NS A/T D/V rs56967655 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,550,810 248,553,833 CopyNumber #32 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E3K V34I T57N E89K I92F A96T A99T R139W A146V L159P S230L S243A T258M V273D % Freq CORP
1 E V T E I A A R A L S S T V 63.13 0.158
2 E V T E I A A R A L S A T V 29.03 0.158
3 E V N E I A T R A P S A T V 3.15 0.158
4 K V T K I A A R A L S S T D 1.08 0.158
5 E V N E I A A R A P S A T V 0.84 0.158
6 E I T E I A A R A L S S T V 0.54 0.158
7 E V T E I T A R A L S S T V 0.46 0.158
8 E V T E I A A W A L S S T V 0.38 0.158
9 E V T E I A A R A P S A T V 0.31 0.158
10 E V T E I A A R V L S A T V 0.23 0.158
11 E V T E F A A R A L S S T V 0.15 0.238
12 K V T K I A A R A L S S T V 0.15 0.158
13 E V N E I A A R A L S S T V 0.15 0.158
14 E V T E I A A R A L L S T V 0.15 0.158
15 E V T E F A A R A P S A T V 0.08 0.238
16 E V T E I T A R A L S A T V 0.08 0.158
17 E V T E I A A R A L S S M V 0.08 0.158

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T6.aApr07-unspliced main_exon CDS chr1 248,387,609 248,388,532 +
3UTR chr1 248,388,532 248,388,535 +