Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T7 Olfactory Receptor

Gene Symbol OR2T71 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR1-44, HsOR1.5.40P
External Ids HGNC: 15019   GeneBank: AF399480, BK004622, NG_004272   
Build #39 labels OR2T7P
Chromosomal location 1:248,441,207-248,442,130 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T27 98.62% 290

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T27 89% 289
Mouse Or2t1 71% 288
Rat Or2t1 71% 286
Cow OR2T27 91% 286
Orang OR2T27 97% 290
Horse OR2T27P 89% 290
Horse OR2T27CP 88% 294
Horse OR2T27HP 88% 290
Chimp OR2T27 98% 290
Chimp OR2T27BP 96% 286

Sequence information

Nucleotide sequence ATGCCGACTTTATCCTTCTGGGTTTGTTCAGCAACGCCCGTTTCCCCTGGCTTCTTTGCC
CTCATTCTCCTGGTCTTTGTGACCTCCATAGCCAGCAACGTGGTCAAGATCATTCTCATC
CACATAGACTCCCGCCTCCACACCCCCATGTACTTCCTGCTCAGCCAGCTCTCCCTCAGG
GACATCCTGTATATTTCCACCATTGTGCCCAAAATGCTGGTCGACCAGGTGATGAGCCAG
AGAGCCATTTCCTTTGCTGGATGCACTGCCCAACACTTCCTCTACTTGACCTTAGCAGGG
GCTGAGTTCTTCCTCCTAGGACTCATGTCCTGTGATCGCTACGTAGCCATCTGCAACCCT
CTGCACTATCCTGACCTCATGAGCCGCAAGATCTGCTGGTTGATTGTGGCGGCAGCCTGG
CTGGGAGGGTCTATCGATGGTTTCTTGCTCACCCCCGTCACCATGCAGTTCCCCTTCTGT
GCCTCTCGGGAGATCAACCACTTCTTCTGCGAGGTGCCTGCCCTTCTGAAGCTCTCCTGC
ACGGACACATCAGCCTACGAGACAGCCATGTATGTCTGCTGTATTATGATGCTCCTCATC
CCTTTCTCTGTGATCTCGGGCTCTTACACAAGAATTCTCATTACTGTTTATAGGATGAGC
GAGGCAGAGGGGAGGCGAAAGGCTGTGGCCACCTGCTCCTCACACATGGTGGTTGTCAGC
CTCTTCTATGGGGCTGCCATGTACACATACGTGCTGCCTCATTCTTACCACACCCCTGAG
CAGGACAAAGCTGTATCTGCCTTCTACACCATCCTCACTCCCATGCTCAATCCACTCATT
TACAGCCTTAGGAACAAGGATGTCACGGGGGCCCTACAGAAGGTTGTTGGGAGGTGTGTG
TCCTCAGGAAAGGTAACCACTTTC
Conceptual translation MPTLSFWVCSATPVSPGFFALILLVFVTSIASNVVKIILIHIDSRLHTPMYFLLSQLSLR
DILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSCDRYVAICNP
LHYPDLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSC
TDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRRKAVATCSSHMVVVS
LFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGALQKVVGRCV
SSGKVTTF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/G T/S 1000GP (YRI)
1 100 -100 SYN C/T Y/Y 1000GP (YRI, YRI)
1 248,442,094 248,442,094 SYN T/G V/V 1000GP (CEU)
1 248,604,542 248,604,542 NS C/T T/M rs61834485 (DbSNP)
1 248,604,563 248,604,562 Ins(2) -/CT rs58223479 (DbSNP)
1 248,605,316 248,605,316 NS C/G T/S rs73147562 (DbSNP)
1 248,605,374 248,605,374 SYN A/G T/T rs1339993 (DbSNP)
1 248,605,395 248,605,395 SYN G/T V/V rs28631666 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,604,160 248,605,440 CopyNumber Variation_71756 (DGV)
1 248,604,260 248,635,197 CopyNumber Variation_71754 (DGV)
1 248,604,408 248,607,431 Deletion, CopyNumber #296 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C111Y R113H D125V Y217H M219T % Freq CORP
1 C R D Y M 85.79 0.094
2 Y R D Y M 8.29 0.094
3 C R V Y M 3.69 0.094
4 Y R V Y M 0.92 0.094
5 C R D Y T 0.54 0.094
6 C R D H M 0.38 0.094
7 C H D Y M 0.38 0.649