Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2U1P Olfactory Receptor

Gene Symbol OR2U1P1 (View this gene in GeneCards)
Family 2
Subfamily U
Pseudogene Yes
CORP pseudogene probability score
Aliases 974I11, AL050339-C, dJ974I11.3, OR6-23, hs6M1-24, HsOR6.3.13P, ORL3154
External Ids HGNC: 8278   GeneBank: BK004667   ORDB: ORL3154   
Build #39 labels OR2U1P, OR2AU1P
Chromosomal location 6:29,262,659-29,264,079 (-)
Cluster 6@29
Synteny CLIC#12
Remarks Disrupted by LTR repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2U2P 70.19% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W1 55% 297
Mouse Or2w1 56% 305
Rat Or2w1 55% 305
Cow OR2U5 77% 307
Orang OR2U2P 70% 312
Horse OR2U1 82% 308
Chimp OR2U2P 73% 311

Expression evidences

Source Accession
ESTs AA912855
GNF Atlas2 gnf1h10891_at

Sequence information

Nucleotide sequence ATGATCAATGATAGTTACTTTGGTTGGCTTATGCTCCTTGGGTTCCCTGGGAAGCCTCAG
CTGGAGATGATCATCTCTGGGGTTGTCTTTTTCTTCTATGCAATTTCTTTGATGGGAAAT
ATGGTCCTTATCCTGCTGCCATTACTGGATAAACATCTCCAAACCCCCATATATTTCTTT
CTTAGAAATCTGGCTATCTTGGATCTTTGTTACACCACAAATATAGTCCCACAGATGTTG
GTCAATGCCTGGGGTAAAGACAAGAAAATCACTTTTGGTGGCTGTGCTTTTCAACTTTTC
ACTAATGTGACGCTATGCACGGTTGAATGTATGCTTCTGGCTGTGATGTCATATGACCCA
TTCAATGCTGTCTGCAAGCCTCTGGACTATATGACCATAATGAACCCCCAACTCTGTCAA
GGCCTGGTGGCCATGACCTGGTTAATTGGTGTCACTAATTGCATGATACTTTCCCCCTGT
CCTGTGAGTCTTCCTCGATGCGGAGACCACCACCTGGATCACTATTTTTGTGAAATATCT
GCAATGGTCAAAATTGCATGTGGGGCTACCACAGTCATGGAGGAAACGAAACCTTATTTG
CATTGTGTTGTTGTTGTTGTTTTCATTTTCCTTGCATCACTTCTTCTCATTCTTGTGTCA
TATGGCTTCATTGCTGTGGCTGTACTCAAGATCAAGTCTGCAGCAGGAAGACAAAAAGCA
TTTGGGACCTGTTTCTCCCATCTCATTGTGGTATCCATCTTCTATGGGACTGTTAGATAT
ATGTATATAGAGCCAGGAAACAGTCCATCTCAGGATGAGGGCAAACTTCTCCATATATTT
TACTCCATTGTTACTCCCACCTTGAACCCATCCCACTAAGGAATAAGGAGTTCAAGTGGG
CCATGAAAAGGCTTATTGGAAAA
Conceptual translation MINDSYFGWLMLLGFPGKPQLEMIISGVVFFFYAISLMGNMVLILLPLLDKHLQTPIYFF
LRNLAILDLCYTTNIVPQMLVNAWGKDKKITFGGCAFQLFTNVTLCTVECMLLAVMSYDP
FNAVCKPLDYMTIMNPQLCQGLVAMTWLIGVTNCMILSPCPVSLPRCGDHHLDHYFCEIS
AMVKIACGATTVMEEKPYLHCVVVVVFIFLASLLLILVSYGFIAVAVLKIKSAAGRQKAF
GTCFSHLIVVSIFYGTVRYMYIEPGNSPSQDEGKLLHIFYSIVTPTLNP/PLRNKEFKW
AMKRLIG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP A/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
6 29,230,577 29,230,577 SNP C/A rs3117328 (DbSNP)
6 29,230,683 29,230,683 SNP C/T rs3130827 (DbSNP)
6 29,230,806 29,230,806 SNP A/C rs73403564 (DbSNP)
6 29,230,921 29,230,921 SNP A/G rs73743658 (DbSNP)
6 29,231,172 29,231,172 SNP A/G rs9257657 (DbSNP)
6 29,262,743 29,262,743 SNP A/C 1000GP (CEU, CHBJPT)
6 29,262,800 29,262,800 SNP C/A 1000GP (CEU, CHBJPT)
6 29,262,906 29,262,906 SNP T/C 1000GP (CEU, CHBJPT)
6 29,263,395 29,263,395 SNP G/A 1000GP (CEU, CHBJPT)
6 29,263,722 29,263,722 SNP G/A 1000GP (CEU)
6 29,264,054 29,264,054 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,228,436 29,231,956 Deletion #192 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
LOC646317.aApr07 main_exon CDS_partial chr6 29,262,703 29,262,993 -