Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2V1 Olfactory Receptor

Gene Symbol OR2V11 (View this gene in GeneCards)
Family 2
Subfamily V
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR5-4, OST265, HsOR5.4.3
External Ids HGNC: 8280   GeneBank: AB065465, AF399482, BK004551, NG_004137   
Build #39 labels OR2V1P
Chromosomal location 5:181,124,360-181,125,304 (-)
Cluster 5@181a
Synteny CLIC#11
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2V2 87.3% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2V1 87% 315
Chimp CONTIG1778.13-3415 97% 315
Mouse Or2v1 88% 315
Rat Or2v1 88% 315
Cow OR2V1 83% 315
Cow OR2V2 81% 315
Cow OR2V2D 81% 314

Sequence information

Nucleotide sequence ATGGGAAGATGGGTGAACCAGTCCTACACAGATGGCTTCTTCCTCTTGGGCATCTTTTCC
CACAGCCAGACTGACCTTGTCCTCTTCTCTGCAGTTATGGTGGTCTTCACAGTGGCCCTC
TGTGGGAATGTCCTCCTCATCTTCCTCATCTACCTGGACGCTGGACTTCACACCCCCATG
TACTTCTTCCTCAGCCAGCTCTCCCTCATGGACCTCATGTTGGTCTGTAACATTGTGCCA
AAGATGGCAGCCAACTTCCTGTCTGGCAGGAAGTCCATCTCCTTTGTGGGCTGTGGCATA
CAAATTGGCTTTTTTGTCTCTCTTGTGGGATCTGAGGGGCTCTTGCTGGGACTCATGGCT
TATGACCGCTACGTGGCCGTTAGCCACCCACTTCACTATCCCATCCTCATGAATCAGAGG
GTCTGTCTCCAGATTACTGGGAGCTCCTGGGCCTTTGGGATAATAGATGGAGTGATTCAG
ATGGTGGCAGCCATGGGCTTACCTTACTGTGGCTCAAGGAGCGTGGATCACTTTTTCTGT
GAGGTACAAGCTTTATTGAAGCTGGCCTGTGCAGACACTTCCCTTTTTGACACCCTCCTC
TTTGCTTGCTGTGTCTTCATGCTTCTCCTTCCCTTCTCCATCATCATGGCCTCCTATGCT
TGCATCCTAGGGGCTGTGCTCCGAATACGCTCTGCTCAGGCCTGGAAAAAAGCCCTGGCC
ACCTGCTCCTCCCACCTAACAGCTGTCACCCTCTTCTATGGGGCAGCCATGTTCATGTAC
CTGAGGCCTAGGCGCTACCGGGCCCCTAGCCATGACAAGGTGGCCTCTATCTTCTACACA
GTCCTTACTCCCATGCTGAACCCCCTCATTTACAGCTTGAGGAATGGGGAGGTGATGGGG
GCACTGAGGAAGGGGCTGGACCGCTGCAGGATTGGCAGCCAGCAC
Conceptual translation MGRWVNQSYTDGFFLLGIFSHSQTDLVLFSAVMVVFTVALCGNVLLIFLIYLDAGLHTPM
YFFLSQLSLMDLMLVCNIVPKMAANFLSGRKSISFVGCGIQIGFFVSLVGSEGLLLGLMA
YDRYVAVSHPLHYPILMNQRVCLQITGSSWAFGIIDGVIQMVAAMGLPYCGSRSVDHFFC
EVQALLKLACADTSLFDTLLFACCVFMLLLPFSIIMASYACILGAVLRIRSAQAWKKALA
TCSSHLTAVTLFYGAAMFMYLRPRRYRAPSHDKVASIFYTVLTPMLNPLIYSLRNGEVMG
ALRKGLDRCRIGSQH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
5 180,551,775 180,551,775 NS C/T R/H rs10035767 (DbSNP)
5 180,551,937 180,551,937 NS C/T R/H rs10073017 (DbSNP)
5 181,124,937 181,124,937 NS C/T R/H 1000GP (CEU)
5 181,124,775 181,124,775 NS T/C H/R 1000GP (CHBJPT)
5 100 -100 NS T/C H/R 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
5 180,433,880 180,614,665 CopyNumber Variation_29766 (DGV)
5 180,433,880 180,633,854 CopyNumber Variation_53320 (DGV)
5 180,545,057 180,598,061 Inversion Variation_59820 (DGV)
5 180,532,601 180,598,197 Inversion Variation_103362 (DGV)
5 180,549,360 180,552,404 CopyNumber #39 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H177R V175A R123H F62S % Freq CORP
1 H V R F 82.80 0.087
2 H V H F 12.75 0.628
3 R V R F 3.69 0.128
4 H A R F 0.46 0.087
5 H V R S 0.31 0.087