Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2V2 Olfactory Receptor

Gene Symbol OR2V21 (View this gene in GeneCards)
Family 2
Subfamily V
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR5-3, HsOR5.4.4, ORL3204
External Ids HGNC: 15341   GeneBank: AB065675, AF399614, BK004246, NM_206880   ORDB: ORL3204   
Build #39 labels OR2V3, OR2V2
Chromosomal location 5:181,154,943-181,155,887 (+)
Cluster 5@181a
Synteny CLIC#11
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2V1 87.3% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2V1 84% 315
Chimp CONTIG1778.10-26511 99% 315
Mouse Or2v1 83% 315
Mouse Or2v2 83% 314
Rat Or2v2b 85% 315
Rat Or2v2c 84% 315
Rat Or2v2 85% 312
Rat Or2v1 82% 315
Cow OR2V2 87% 315
Cow OR2V2D 85% 314

Sequence information

Nucleotide sequence ATGGAGACGTGGGTGAACCAGTCCTACACAGATGGCTTCTTCCTCTTAGGCATCTTCTCC
CACAGTACTGCTGACCTTGTCCTCTTCTCCGTGGTTATGGCGGTCTTCACAGTGGCCCTC
TGTGGGAATGTCCTCCTCATCTTCCTCATCTACATGGACCCTCACCTTCACACCCCCATG
TACTTCTTCCTCAGCCAGCTCTCCCTCATGGACCTCATGTTGGTCTGTACCAATGTGCCA
AAGATGGCAGCCAACTTCCTGTCTGGCAGGAAGTCCATCTCCTTTGTGGGCTGTGGCATA
CAAATTGGCCTCTTTGTCTGTCTTGTGGGATCTGAGGGGCTCTTGCTGGGACTCATGGCT
TATGACCGCTATGTGGCCATTAGCCACCCACTTCACTATCCCATCCTCATGAATCAGAGG
GTCTGTCTCCAGATTACTGGGAGCTCCTGGGCCTTTGGGATAATCGATGGCTTGATCCAG
ATGGTGGTAGTAATGAATTTCCCCTACTGTGGCTTGAGGAAGGTGAACCATTTCTTCTGT
GAGATGCTATCCTTGTTGAAGCTGGCCTGTGTAGACACATCCCTGTTTGAGAAGGTGATA
TTTGCTTGCTGTGTCTTCATGCTTCTCTTCCCATTCTCCATCATCGTGGCCTCCTATGCT
CACATTCTAGGGACTGTGCTGCAAATGCACTCTGCTCAGGCCTGGAAAAAGGCCCTGGCC
ACCTGCTCCTCCCACCTGACAGCTGTCACCCTCTTCTATGGGGCAGCCATGTTCATCTAC
CTGAGGCCTAGGCACTACCGGGCCCCCAGCCATGACAAGGTGGCCTCTATCTTCTACACG
GTCCTTACTCCCATGCTCAACCCCCTCATTTACAGCTTGAGGAACAGGGAGGTGATGGGG
GCACTGAGGAAGGGGCTGGACCGCTGCAGGATCGGCAGCCAGCAC
Conceptual translation METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPM
YFFLSQLSLMDLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMA
YDRYVAISHPLHYPILMNQRVCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFC
EMLSLLKLACVDTSLFEKVIFACCVFMLLFPFSIIVASYAHILGTVLQMHSAQAWKKALA
TCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYTVLTPMLNPLIYSLRNREVMG
ALRKGLDRCRIGSQH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
5 180,582,321 180,582,321 NS A/G I/V rs57951228 (DbSNP)
5 180,582,043 180,582,043 NS C/T A/V rs17617270 (DbSNP)
5 180,582,604 180,582,604 NS G/A R/H rs2546423 (DbSNP)
5 180,582,314 180,582,314 SYN C/T Y/Y rs12108779 (DbSNP)
5 181,155,604 181,155,604 NS A/G H/R 1000GP (CEU, CHBJPT)
5 181,155,043 181,155,043 NS C/T A/V 1000GP (CEU)
5 100 -100 SYN C/T V/V 1000GP (YRI, YRI)
5 100 -100 NS A/G I/V 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
5 180,433,880 180,614,665 CopyNumber Variation_29766 (DGV)
5 180,553,399 180,587,578 CopyNumber Variation_36381 (DGV)
5 180,433,880 180,633,854 CopyNumber Variation_53320 (DGV)
5 180,545,057 180,598,061 Inversion Variation_59820 (DGV)
5 180,532,601 180,598,197 Inversion Variation_103362 (DGV)
5 180,581,843 180,584,887 CopyNumber #110 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L64F I127V L209P H221R % Freq CORP
1 L I L R 61.14 0.087
2 L I L H 37.63 0.087
3 L V L R 0.61 0.087
4 F I L R 0.38 0.044
5 L I P R 0.23 0.087

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2V2.aApr07-unspliced main_exon CDS chr5 181,154,943 181,155,887 +
3UTR chr5 181,155,887 181,155,890 +