Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2W1 Olfactory Receptor

Gene Symbol OR2W11 (View this gene in GeneCards)
Family 2
Subfamily W
Pseudogene No
CORP pseudogene probability score 0.27 (functional)
Aliases AL035402-B, dJ88J8.1, OR6-13, hs6M1-15, HsOR6.3.2, ORL678
External Ids HGNC: 8281   GeneBank: AF399628, BK004522, HSA302594-HSA302603, NM_030903   ORDB: ORL678   
Build #39 labels OR2W1
Chromosomal location 6:29,044,216-29,045,175 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2G3 60% 305
OR2W4P 61.31% 305
OR2W6P 64.26% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W1 85% 306
Chimp CONTIG696.81-17531 97% 320
Mouse Or2w1 86% 317
Mouse Or2w1b 85% 317
Rat Or2w1c 85% 317
Rat Or2w1 86% 310
Cow OR2W1 88% 320
Cow OR2W1D 87% 317

Expression evidences

Source Accession
ESTs DB457283
mRNA BC103872
GNF Atlas2 221451_s_at

Sequence information

Nucleotide sequence ATGGACCAAAGCAATTATAGTTCTTTACATGGTTTTATTCTGCTTGGCTTCTCTAACCAT
CCAAAAATGGAGATGATCCTGTCAGGAGTTGTCGCCATCTTCTACTTAATTACATTGGTG
GGTAACACAGCCATCATTCTTGCATCTCTCCTGGATTCCCAGCTTCATACACCAATGTAC
TTTTTCCTCAGAAATTTATCTTTCCTAGATCTATGTTTCACAACCAGCATCATCCCTCAG
ATGCTGGTCAACTTGTGGGGACCTGATAAGACCATCAGCTATGTGGGTTGTATCATCCAA
CTCTATGTTTACATGTGGTTGGGCTCAGTTGAGTGCCTTCTCCTGGCTGTTATGTCCTAT
GATCGTTTTACAGCTATATGTAAGCCCTTGCATTATTTTGTAGTCATGAACCCACATCTA
TGTCTAAAGATGATTATCATGATCTGGAGTATTAGTTTGGCCAATTCTGTAGTATTATGT
ACACTCACTCTGAATTTGCCCACATGTGGAAACAACATTCTGGATCATTTCTTGTGTGAG
TTGCCAGCTCTGGTCAAGATAGCTTGTGTAGACACCACAACAGTTGAAATGTCTGTTTTC
GCTTTAGGCATTATAATTGTCCTCACACCTCTCATCCTTATTCTTATATCCTATGGCTAC
ATTGCCAAAGCTGTGCTGAGAACGAAGTCAAAAGCAAGCCAGCGAAAAGCAATGAATACC
TGTGGATCTCATCTTACTGTAGTGTCTATGTTCTATGGAACTATTATCTACATGTACCTG
CAACCAGGTAACAGGGCTTCCAAAGACCAGGGCAAGTTCCTCACCCTCTTTTACACCGTC
ATCACTCCAAGTCTCAACCCGCTCATTTACACCTTAAGAAATAAGGACATGAAGGATGCC
CTGAAGAAACTGATGAGATTTCACCACAAATCTACAAAAATAAAGAGGAATTGCAAGTCA
Conceptual translation MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMY
FFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSY
DRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCE
LPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMNT
CGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKDMKDA
LKKLMRFHHKSTKIKRNCKS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS C/T D/N 1000GP (YRI, YRI)
6 100 -100 SYN G/A T/T 1000GP (YRI)
6 29,012,059 29,012,059 SYN C/T K/K rs7341214 (DbSNP)
6 29,012,067 29,012,067 NS C/T D/N rs35771565 (DbSNP)
6 29,012,068 29,012,068 SYN C/T K/K rs7341215 (DbSNP)
6 29,012,116 29,012,116 SYN A/G T/T rs7341218 (DbSNP)
6 29,012,712 29,012,712 NS C/T V/M rs34892006 (DbSNP)
6 29,044,290 29,044,290 NS C/T D/N 1000GP (CEU, CHBJPT)
6 29,044,339 29,044,339 SYN G/A T/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,009,993 29,013,052 CopyNumber #40 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D296N M81V % Freq CORP
1 D M 72.43 0.484
2 N M 23.96 0.484
3 D V 3.61 0.484

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2W1.aApr07-unspliced main_exon 3UTR chr6 29,044,213 29,044,216 -
CDS chr6 29,044,216 29,045,175 -
5UTR chr6 29,045,175 29,045,240 -