Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2W2P Olfactory Receptor

Gene Symbol OR2W2P1 (View this gene in GeneCards)
Family 2
Subfamily W
Pseudogene Yes
CORP pseudogene probability score
Aliases dJ313I6.2, hs6M1-30P, HsOR6.2.5P, ORL3160
External Ids HGNC: 13970   GeneBank: AF399493, NG_004279   ORDB: ORL3160   
Build #39 labels OR2W2P
Chromosomal location 6:28,033,914-28,034,861 (+)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2W1 61.84% 304
OR2W3 67.55% 302
OR2W6P 63.55% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W3 67% 310
Mouse Or2w2 81% 304
Rat Or2w2 81% 304
Cow OR2W2 82% 304
Orang OR2W2 85% 311
Horse OR2W2 85% 304
Chimp OR2W3 68% 304

Expression evidences

Source Accession
ESTs BF360154

Sequence information

Nucleotide sequence CCACTGTCATGACCAACCAGAGCTGCCCAGAAACAGTTCATCTTACTGGGTTTCTCAGGC
AGACCCAGGCTGGAGCATGTCCTCTTTGTGTTTGTCCTCATCTTCTACCTTGTGACCTTA
GTGGGCAACATCATCATTATCTTGATCTCCCACCTGGACCCCTGCCTCCACATGCCCATG
TACTTCTTCCTCACTAACTTGTCTTTCCTAGATCTCTGCTTCACCACCAGTTCTATCCCC
CAGCTGCTTTTCAATCTAGGCAGCCCAGGCAAGACTATCAGCCACACGGGCTGTGCCATC
CAGCTCTTCATGTTCCTGGGCCTGGGTGGCAAGAGTGTATTCTCTTGGCAGCCGTGGCCT
ATGACCGCTTCATTGCAATCTGCAAGCCCCTTCACTATTCTGTCATTATGCACCCTCAGC
TGTGCTGGAAGTTGGTGTCTGTGGCCCGGGGGTGTTGGACTCCTCAGTTCTCTAGTTATG
TCTCCTGTGACTATGAAGCTGCCACGATGTGGAAGATGTAAGTTGAAACATTTCCTGTGT
GAGATGCCAGCTCTAATAAAAATCACCTGTGTGGACACAGTGGCTATGGAGAGCACTGTT
TTCACCTTATCGGTAGTAATTGTCCTGATGCCTTTGTGTCTTATCCTCATCTCTTATAGC
TACATTGCCCTAGCAGTGCTGAGAATCAAGTCAGCCGCAGGAAGAAGGAAGGCCTTCAAT
ATGTGCGGGTCCCACCTCACCGTGGTCTCCTTGTTTTATGGGAATATTATCTATATGTAT
ATGCAACCATGAAATAATTCTTCTCAGGACCAAGGGAAGTTCCTTACCCTTTTCTACAAC
TTAATGACCCCCATGTTAAACCCTGTCATCTATACACTGAGAAACAAGGATGTAAAAGGT
GCACTGAAGAGGCTTGTGTCTAGAAAACACAGTGACAGTGACTGCTCT
Conceptual translation PLSXTRAAQKQFILLGFSGRPRLEHVLFVFVLIFYLVTLVGNIIIILISHLDPCLHMPM
YFFLTNLSFLDLCFTTSSIPQLLFNLGSPGKTISHTGCAIQLFMFLGLGG/ECILLAAV
AYDRFIAICKPLHYSVIMHPQLCWKLVSVARGCWTPQFSSYVS\TMKLPRCGRCKLKHF
LCEMPALIKITCVDTVAMESTVFTLSVVIVLMPLCLILISYSYIALAVLRIKSAAGRRKA
FNMCGSHLTVVSLFYGNIIYMYMQPXNSSQDQGKFLTLFYNLMTPMLNPVIYTLRNKDV
KGALKRLVSRKHSDSDCS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)
6 28,001,718 28,001,717 Ins(1) -/G rs35607038 (DbSNP)
6 28,002,045 28,002,045 SNP A/G rs9393873 (DbSNP)
6 28,002,388 28,002,388 SNP A/G rs149943 (DbSNP)
6 28,034,267 28,034,267 SNP G/A 1000GP (CEU, CHBJPT)
6 28,034,361 28,034,361 SNP G/A 1000GP (CEU, CHBJPT)
6 28,034,610 28,034,610 SNP G/A 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.