Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2W3 Olfactory Receptor

Gene Symbol OR2W31 (View this gene in GeneCards)
Family 2
Subfamily W
Pseudogene No
CORP pseudogene probability score 0.54 (pseudogene)
Aliases OR1-49, HsOR1.5.15
External Ids HGNC: 15021   GeneBank: AB065949, AF399491, BK004456, HSM805734, NM_001001957   
Build #39 labels OR2W8P, OR2W3P
Chromosomal location 1:247,895,587-247,896,528 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2W2P 67.55% 302
OR2W6P 66.56% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W3 89% 313
Chimp CONTIG*********** 98% 314
Mouse Or2w3c 85% 313
Mouse Or2w3 85% 313
Mouse Or2w3b 83% 313
Rat Or2w2 73% 304
Cow OR2W3 89% 310

Expression evidences

Source Accession
ESTs N75737
mRNA EU831842
GNF Atlas2 gnf1h02157_at

Sequence information

Nucleotide sequence ATGGATGGAACCAATGGCAGCACCCAAACCCATTTCATCCTACTGGGATTCTCTGACCGA
CCCCATCTGGAGAGGATCCTCTTTGTGGTCATCCTGATCGCGTACCTCCTGACCCTCGTA
GGCAACACCACCATCATCCTGGTGTCCCGGCTGGACCCCCACCTCCACACCCCCATGTAC
TTCTTCCTCGCCCACCTTTCCTTCCTGGACCTCAGTTTCACCACCAGCTCCATCCCCCAG
CTGCTCTACAACCTTAATGGATGTGACAAGACCATCAGCTACATGGGCTGTGCCATCCAG
CTCTTCCTGTTCCTGGGTCTGGGTGGTGTGGAGTGCCTGCTTCTGGCTGTCATGGCCTAT
GACCGGTGTGTGGCTATCTGCAAGCCCCTGCACTACATGGTGATCATGAACCCCAGGCTC
TGCCGGGGCTTGGTGTCAGTGACCTGGGGCTGTGGGGTGGCCAACTCCTTGGCCATGTCT
CCTGTGACCCTGCGCTTACCCCGCTGTGGGCACCACGAGGTGGACCACTTCCTGCGTGAG
ATGCCCGCCCTGATCCGGATGGCCTGCGTCAGCACTGTGGCCATCGAAGGCACCGTCTTT
GTCCTGGCGGTGGGTGTTGTGCTGTCCCCCTTGGTGTTTATCCTGCTCTCTTACAGCTAC
ATTGTGAGGGCTGTGTTACAAATTCGGTCAGCATCAGGAAGGCAGAAGGCCTTCGGCACC
TGCGGCTCCCATCTCACTGTGGTCTCCCTTTTCTATGGAAACATCATCTACATGTACATG
CAGCCAGGAGCCAGTTCTTCCCAGGACCAGGGCATGTTCCTCATGCTCTTCTACAACATT
GTCACCCCCCTCCTCAATCCTCTCATCTACACCCTCAGAAACAGAGAGGTGAAGGGGGCA
CTGGGAAGGTTGCTTCTGGGGAAGAGAGAGCTAGGAAAGGAG
Conceptual translation MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMY
FFLAHLSFLDLSFTTSSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAY
DRCVAICKPLHYMVIMNPRLCRGLVSVTWGCGVANSLAMSPVTLRLPRCGHHEVDHFLRE
MPALIRMACVSTVAIEGTVFVLAVGVVLSPLVFILLSYSYIVRAVLQIRSASGRQKAFGT
CGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGA
LGRLLLGKRELGKE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,059,147 248,059,146 Ins(1) -/G rs34301279 (DbSNP)
1 248,059,476 248,059,476 NS A/C E/D rs12139390 (DbSNP)
1 248,059,151 248,059,151 NS A/G Y/C rs61748699 (DbSNP)
1 248,059,078 248,059,078 NS A/G T/A rs61752499 (DbSNP)
1 248,059,483 248,059,483 NS A/G I/V rs61756679 (DbSNP)
1 248,059,456 248,059,456 NS A/G I/V rs12135078 (DbSNP)
1 248,059,703 248,059,703 NS A/T K/M rs11204545 (DbSNP)
1 248,059,394 248,059,394 NS C/G S/C rs12083024 (DbSNP)
1 248,059,712 248,059,712 NS C/T T/M rs11204546 (DbSNP)
1 248,059,150 248,059,150 NS C/T R/C rs61748698 (DbSNP)
1 248,059,423 248,059,423 NS C/T R/C rs10888267 (DbSNP)
1 248,059,252 248,059,252 NS C/T R/W rs61750779 (DbSNP)
1 248,059,602 248,059,602 SYN C/T F/F rs61748719 (DbSNP)
1 247,896,121 247,896,121 NS C/T R/C 1000GP (CEU, CHBJPT)
1 247,896,174 247,896,174 NS A/C E/D 1000GP (CEU, CHBJPT)
1 247,896,154 247,896,154 NS G/A V/I 1000GP (CEU, CHBJPT)
1 247,896,401 247,896,401 NS T/A M/K 1000GP (CEU, CHBJPT)
1 247,896,410 247,896,410 NS T/C M/T 1000GP (CEU, CHBJPT)
1 247,895,625 247,895,625 SYN C/T I/I 1000GP (CHBJPT)
1 247,895,950 247,895,950 NS C/T R/W 1000GP (CHBJPT)
1 247,896,502 247,896,502 SYN C/T L/L 1000GP (CHBJPT)
1 100 -100 NS G/A A/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T F/F 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
CopyNumber 1 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A64T C88R C88Y R122W C169S R179C V190I E196D V199I M272K M275T % Freq CORP
1 A C C R C C I D V K T 35.10 0.359
2 A C C R C R V E V M M 26.65 0.703
3 A C C R C R V D V M M 12.60 0.703
4 A C C W C R V E V M M 6.76 0.977
5 A C C R C R V D V K T 4.53 0.703
6 A C C R C R I D V K T 2.30 0.703
7 A C C R C R V E V K T 2.00 0.703
8 A C C R S C V E V K T 1.77 0.359
9 A C C R C C V E V K T 1.54 0.359
10 A C C R C C I D V M M 1.08 0.359
11 A C C R C C V D V K T 1.00 0.359
12 A R Y W C R V E V M M 0.69 0.977
13 T C Y R C R V E V M M 0.46 0.703
14 A C C W C C V E V K T 0.38 0.909
15 A C C R C R I D V M M 0.31 0.703
16 A C C R C R V E I M M 0.31 0.703
17 A C Y W C R V E V M M 0.31 0.977
18 A C C W C C I E V K T 0.23 0.909
19 A C C R C C V D V M M 0.15 0.359
20 A C C W C C I D V K T 0.15 0.909
21 A C C W C R V E I M M 0.15 0.977
22 A C C W C R V D V M M 0.15 0.977
23 A R Y W C R V E V K T 0.15 0.977
24 A C C W C R V E V K T 0.15 0.977
25 A C C W C R V D V K T 0.15 0.977
26 A R Y R C R V D V M M 0.15 0.703
27 A C C R C R V D V M T 0.08 0.703
28 A R Y R C C I E V K T 0.08 0.359
29 A C Y R C C V E V K T 0.08 0.359
30 A R Y R C R V D V K T 0.08 0.703
31 A R Y R C C I D V K T 0.08 0.359
32 A C Y R C R V E V K T 0.08 0.703
33 T C C R C R V D V M M 0.08 0.703
34 A C C R C R V E V M T 0.08 0.703
35 A C C W C C I E V M M 0.08 0.909
36 A C C R C C I E V K T 0.08 0.359

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
TRIM58andOR2W3.bApr07 exon_5UTR chr1 247,867,975 247,868,063 +
exon_5UTR chr1 247,875,900 247,876,037 +
main_exon 5UTR chr1 247,895,557 247,895,587 +
CDS chr1 247,895,587 247,896,528 +
3UTR chr1 247,896,528 247,897,408 +