Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2W4P Olfactory Receptor

Gene Symbol OR2W4P1 (View this gene in GeneCards)
Family 2
Subfamily W
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-5, OR6-6, HsOR6.2.4P, ORL3159
External Ids HGNC: 15071   GeneBank: BK004560, BK004743, NG_004261   ORDB: ORL3159   
Build #39 labels OR2W4P
Chromosomal location 6:27,977,150-27,978,072 (+)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2W1 61.31% 305
OR2W3 62.95% 305
OR2W6P 66.12% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W4 90% 308
Chimp CONTIG415.106-32590 98% 308
Mouse Or2w4 85% 308
Rat Or2w6 68% 308
Cow OR2W4 89% 308

Sequence information

Nucleotide sequence ATGGAAAAATCCAATGTCAGCTCAGTGTATGGTTTTATCTTGGTGGGTTTCTCTGATCGT
CCCAAGCTGGAGATGGTGCTCTTTACAGTAAATTTTATTCTGTATTCAGTGGCTGTGCTG
GGAAATTCAACCATAATCCTTGTGTGTATATTAGACTCTCAACTTCATACCCCAATGTAC
TTCTTTCTGGCAAATCTTTCCTTTCTAGATCTCTGCTTCAGTACTAGTTGCATCCCACAA
ATGCTGGTAAACCTCTGGGGCCCTGACAAGACTATTAGCTGTGCTGGCTGTGTTGTCCAG
CTTTTCTCTTTCCTTTCTGTCAGGGGAATTGAGTGCATCCTTCTGGCTGTCATGGCCTAT
GACAGCTATGCTGCAGTCTGCAAACCGTTGCGCTATCTGGTCATTATGCACCTCCAGCTG
TGTCTAGGACTGATGGCTGCAGCCTGGGGGAGTGGACTGGTCAATGCCGTTGTCATGTCA
CCACTAACAATGACCCTCTCCAGAAGTGGCCGCCGCCGAGTTAACCATTTCCTCTGTGAA
AGCCAGCACTGATCAAGATGGCTTGTTTGGATGTTCGTGCAGTGGAAATGCTGGCTTTTG
CTTTTGCCGTTCTCATTGTCCTACTGCCCCTCACTCTTATTCTTGTCTCCTACGGCTACA
TTGCTGCAGCTGTGCTAAGCATCAAGTCAGCTGCCAGGCAATGGAAGGCCTTCCATACCT
GTAGCTCTCACCTCACAGTGGTCTCCCTGTTTTATGGGAGCATCATCTATATGTATATGC
AGCCAGGAAACAGTTCTTCCCAAGACCAAGGCAAGTTTCTCACTCTCTTCTACAACCTGG
TGACTCCTATGTTGAATCTGCTCATCTATACTTTAAGGAATAAGGAGGTGAAAGGAGCAC
TGAAGAAGGTTTTGGGGAGGCAA
Conceptual translation MEKSNVSSVYGFILVGFSDRPKLEMVLFTVNFILYSVAVLGNSTIILVCILDSQLHTPMY
FFLANLSFLDLCFSTSCIPQMLVNLWGPDKTISCAGCVVQLFSFLSVRGIECILLAVMAY
DSYAAVCKPLRYLVIMHLQLCLGLMAAAWGSGLVNAVVMSPLTMTLSRSGRRRVNHFLCE
/PALIKMACLDVRAVEMLAFAFAVLIVLLPLTLILVSYGYIAAAVLSIKSAARQWKAFH
TCSSHLTVVSLFYGSIIYMYMQPGNSSSQDQGKFLTLFYNLVTPMLNLLIYTLRNKEVKG
ALKKVLGRQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 27,945,298 27,945,297 Ins(1) -/C rs34858927 (DbSNP)
6 27,945,396 27,945,396 SNP A/G rs28360499 (DbSNP)
6 27,945,741 27,945,741 SNP A/G rs11752815 (DbSNP)
6 27,945,178 27,945,178 SNP A/G rs12524914 (DbSNP)
6 27,945,640 27,945,640 SNP C/T rs72848774 (DbSNP)
6 27,977,450 27,977,450 SNP C/T 1000GP (CEU)
6 27,977,618 27,977,618 SNP G/A 1000GP (CEU)
6 27,977,862 27,977,862 SNP C/T 1000GP (CEU)
6 27,977,963 27,977,963 SNP A/G 1000GP (CHBJPT)
6 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.