Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2W5 Olfactory Receptor

Gene Symbol OR2W51 (View this gene in GeneCards)
Family 2
Subfamily W
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR1.5.2P
External Ids HGNC: 15424   GeneBank: AF399492, NM_001004698   
Build #39 labels OR2W5P
Chromosomal location 1:247,491,128-247,492,087 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2W6P 63.59% 195

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W11 79% 203
Chimp CONTIG658.80-17961 98% 320
Mouse Or2w6 64% 193
Rat Or2w6 63% 198
Cow OR2W6 63% 198

Expression evidences

Source Accession
ESTs CR746895
mRNA BC137204

Sequence information

Nucleotide sequence ATGGGAAAGGACAATGCCAGTTACCTACAGGCATTCATCCTGGTGGGCTCTTCTGATCGG
CCTGGACTGGAGAAAATTCTCTTTGCTGTTATCTTGATCTTCTGCATCCTGACCCTGGTG
GGCAACACTGCCATCATCCTCTTGCTGGTCATGGATGTCAGGCTCCACACACCCATGTAC
TTCTTTCTTGGGAATCTGTCTTTCTTAGATCTCTGCTTTACAGCAAGCATTGCCCCTCAG
CTGCTGTGGAACCTGGGGGGTCCAGAGAAGACCATCACCTACCACGGCTGTGTGGCCCAA
CTCTACATCTACATGATGCTGGGCTCCACCGAGTGCGTCCTCCTGGTTGTCATGTCCCAT
GACCGCTATGTGGCCGTCTGCCGGTCCCTGCACTACATGGCAGTCATGCGCCCACATCTC
TGCCTGCAGCTGGTGACTGTGGCCTGGTGCTGTGGCTTCCTAAACTCCTTCATCATGTGT
CCTCAGACGATGCAGCTCTCCCGGTGTGGACGTCGCAGGGTGGACCACTTCCTGTGTGAG
ATGCCTGCTCTTATTGCCATGTCTTGTGAGGAAACCATGCTGGTAGAAGCGATTCACCTT
TGCCCTGGGGGTGGCTCTCCTCCTGGTGCCGCTCTCCCTCATCCTCATCTCCTATGGCGT
GATTGCAGCCGCGGTGCTGAGGATGAAGTCAGCAGCAGGGCGAAAGAAAGCCTTCCACAC
CTGCTCTTCTCACCTCACAGTGGTCTCTCTCTTCTACGGAACCATCATCTACGTGTACCT
GAAGCCGGCCAACAGCTACTCCCAAGATCAGGGGAAGTTCCTGACTCTCTTCTACACCAT
CGTCATTCCCAGCATCAACCCCCTCATCTACACTTTGAGGAACAAGGATGTGAAGGGGAC
CATGAAGAAACTTCTGGGGTGGGAGAAAGGGGCTGGGGAGCCTCAACGAGGGGAACACTC
Conceptual translation MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMY
FFLGNLSFLDLCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSH
DRYVAVCRSLHYMAVMRPHLCLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCE
MPALIAMSCEETMLVEAIHLCPGGGSPPGAALPHPHLLWRDCSRGAEDEVSSRAKESLPH
LLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHHRHSQHQPPHLHFEEQGCEGD
HEETSGVGERGWGASTRGTL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 nonsense SNP G/T G/* 1000GP (YRI)
1 100 -100 NS G/A D/N 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A L/L 1000GP (YRI, YRI, YRI)
1 247,491,196 247,491,196 SYN G/A L/L 1000GP (CEU, CHBJPT)
1 247,491,691 247,491,691 SYN T/C S/S 1000GP (CEU, CHBJPT)
1 247,491,900 247,491,900 NS G/A R/H 1000GP (CHBJPT)
1 247,491,973 247,491,973 SYN T/C H/H 1000GP (CEU, CHBJPT)
1 247,654,498 247,654,498 SYN A/G L/L rs61070846 (DbSNP)
1 247,654,993 247,654,993 SYN C/T S/S rs10925061 (DbSNP)
1 247,655,051 247,655,051 NS C/T P/S rs71642416 (DbSNP)
1 247,655,275 247,655,275 SYN C/T H/H rs12141850 (DbSNP)
1 247,655,365 247,655,365 NS C/G C/W rs74152606 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,654,330 247,657,389 Deletion #181 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D4N G22* D70N I158N A183T G225S R258H Q284* W312C % Freq CORP
1 D G D I A G R Q W 91.32 1.000
2 D G D I A G R Q C 2.84 1.000
3 D * D I A G R Q W 1.61 1.200
4 D G D I T G R Q C 1.31 1.000
5 N G D N A G R Q W 0.84 1.000
6 D G N I A G R Q C 0.84 1.000
7 D G D I A G R * W 0.61 1.200
8 D G D I A S R Q W 0.31 1.000
9 D G D I A G H Q W 0.15 1.000
10 D G N I A G R Q W 0.08 1.000
11 D G D I T G R Q W 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2W5.aApr07-unspliced main_exon CDS chr1 247,491,128 247,492,087 +
3UTR chr1 247,492,087 247,492,409 +