Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2Z1 Olfactory Receptor

Gene Symbol OR2Z11 (View this gene in GeneCards)
Family 2
Subfamily Z
Pseudogene No
CORP pseudogene probability score 0.8 (pseudogene)
Aliases OR19-4, HsOR19.2.1, ORL3763, ORL3764
External Ids HGNC: 15391   GeneBank: AB065930, AF399619, BK004262, NM_001004699   ORDB: ORL3763, ORL3764   
Build #39 labels OR2Z1
Chromosomal location 19:8,731,029-8,731,970 (+)
Cluster 19@9a
Synteny CLIC#41
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T32P 54% 300
OR2T35 53.29% 304
OR2T8 53.47% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2Z3 74% 269
Mouse Or2z8 75% 311
Rat Or2z10-ps 71% 283
Cow OR2Z11 78% 309
Orang OR2T27 54% 308
Horse OR2Z1B 86% 311
Chimp OR2T27 53% 308

Expression evidences

Source Accession
mRNA BC151149
GNF Atlas2 gnf1h10963_at

Sequence information

Nucleotide sequence ATGGGGGATGTGAATCAGTCGGTGGCCTCAGACTTCATTCTGGTGGGCCTCTTCAGTCAC
TCAGGATCACGCCAGCTCCTCTTCTCCCTGGTGGCTGTCATGTTTGTCATAGGCCTTCTG
GGCAACACCGTTCTTCTCTTCTTGATCCGTGTGGACTCCCGGCTCCATACACCCATGTAC
TTCCTGCTCAGCCAGCTCTCCCTGTTTGACATTGGCTGTCCCATGGTCACCATCCCCAAG
ATGGCATCAGACTTTCTGCGGGGAGAAGGTGCCACCTCCTATGGAGGTGGTGCAGCTCAA
ATATTCTTCCTCACACTGATGGGTGTGGCTGAGGGCGTCCTGTTGGTCCTCATGTCTTAT
GACCGTTATGTTGCTGTGTGCCAGCCCCTGCAGTATCCTGTACTTATGAGACGCCAGGTA
TGTCTGCTGATGATGGGCTCCTCCTGGGTGGTAGGTGTGCTCAACGCCTCCATCCAGACC
TCCATCACCCTGCATTTTCCCTACTGTGCCTCCCGTATTGTGGATCACTTCTTCTGTGAG
GTGCCAGCCCTACTGAAGCTCTCCTGTGCAGATACCTGTGCCTACGAGATGGCGCTGTCC
ACCTCAGGGGTGCTGATCCTAATGCTCCCTCTTTCCCTCATCGCCACCTCCTACGGCCAC
GTGTTGCAGGCTGTTCTAAGCATGCGCTCAGAGGAGGCCAGACACAAGGCTGTCACCACC
TGCTCCTCGCACATCACGGTAGTGGGGCTCTTTTATGGTGCCGCCGTGTTCATGTACATG
GTGCCTTGCGCCTACCACAGTCCACAGCAGGATAACGTGGTTTCCCTCTTCTATAGCCTT
GTCACCCCTACACTCAACCCCCTTATCTACAGTCTGAGGAATCCGGAGGTGTGGATGGCT
TTGGTCAAAGTGCTTAGCAGAGCTGGACTCAGGCAAATGTGC
Conceptual translation MGDVNQSVASDFILVGLFSHSGSRQLLFSLVAVMFVIGLLGNTVLLFLIRVDSRLHTPMY
FLLSQLSLFDIGCPMVTIPKMASDFLRGEGATSYGGGAAQIFFLTLMGVAEGVLLVLMSY
DRYVAVCQPLQYPVLMRRQVCLLMMGSSWVVGVLNASIQTSITLHFPYCASRIVDHFFCE
VPALLKLSCADTCAYEMALSTSGVLILMLPLSLIATSYGHVLQAVLSMRSEEARHKAVTT
CSSHITVVGLFYGAAVFMYMVPCAYHSPQQDNVVSLFYSLVTPTLNPLIYSLRNPEVWMA
LVKVLSRAGLRQMC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 8,842,168 8,842,168 NS A/C M/L rs61746161 (DbSNP)
19 8,842,138 8,842,138 NS A/C I/L rs73489595 (DbSNP)
19 8,841,461 8,841,461 NS A/G H/R rs61746162 (DbSNP)
19 8,841,802 8,841,802 NS C/T R/C rs58741481 (DbSNP)
19 8,841,793 8,841,793 NS C/T L/F rs61746164 (DbSNP)
19 8,841,891 8,841,891 SYN A/C P/P rs11881829 (DbSNP)
19 8,841,810 8,841,810 SYN A/G V/V rs59262334 (DbSNP)
19 8,841,807 8,841,807 SYN A/G Q/Q rs1078042 (DbSNP)
19 8,841,963 8,841,963 SYN T/C D/D rs890848 (DbSNP)
19 8,841,558 8,841,558 SYN T/C H/H rs28324 (DbSNP)
19 8,731,196 8,731,196 SYN T/C H/H 1000GP (CEU, CHBJPT)
19 100 -100 NS G/A R/H 1000GP (YRI)
19 100 -100 SYN T/C H/H 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
19 8,820,095 8,853,315 CopyNumber Variation_0808 (DGV), Variation_2239 (DGV), Variation_5080 (DGV)
19 8,804,784 8,875,725 CopyNumber Variation_5079 (DGV)
19 8,830,080 8,881,965 CopyNumber Variation_35691 (DGV)
CopyNumber 237 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R24H L135F % Freq CORP
1 R L 97.05 0.966
2 H L 1.75 0.966
3 R F 1.20 0.966

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2Z1.aApr07-unspliced main_exon CDS chr19 8,731,029 8,731,970 +
3UTR chr19 8,731,970 8,731,973 +