Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR3A1 Olfactory Receptor

Gene Symbol OR3A11 (View this gene in GeneCards)
Family 3
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases OR17-15, OR17-40, OLFRA03, hg138, HsOR17.1.11, ORL520, ORL594
External Ids HGNC: 8282   GeneBank: AF087924, BC069414, BK004238, HSOR1740, HSU04683, NM_002550   ORDB: ORL520, ORL594   
Build #39 labels OR3A1
Chromosomal location 17:3,291,638-3,292,582 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs863362 (AA change=W/* ) and rs703903 (highly conserved AA)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR3A2 81.53% 314
OR3A3 77.71% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR3A1 86% 315
Dog OR3A1H 84% 315
Chimp CONTIG1419.14-7506 98% 315
Mouse Or3a1 85% 315
Mouse Or3a1c 83% 315
Mouse Or3a1b 81% 315
Mouse Or3a1d 81% 315
Rat Or3a1 85% 315
Rat Or3a1e 84% 315
Rat Or3a1f 80% 315
Cow OR3A1 87% 314
Cow OR3A2 81% 315
Cow OR3A2B 80% 314

Expression evidences

Source Accession
mRNA BC096190
GNF Atlas2 221353_at

Sequence information

Nucleotide sequence ATGCAGCCAGAATCTGGGGCCAATGGAACAGTCATTGCTGAGTTCATCCTGCTGGGCTTG
CTGGAGGCGCCAGGGCTGCAGCCAGTTGTCTTTGTGCTCTTCCTCTTTGCCTACCTGGTC
ACGGTCAGGGGCAACCTCAGCATCCTGGCAGCTGTCTTGGTGGAGCCCAAACTCCACACC
CCCATGTACTTCTTCCTGGGGAACCTATCAGTGCTGGATGTTGGGTGCATCAGCGTCACT
GTTCCATCAATGTTGAGTCGTCTCCTGTCCCGCAAGCGTGCAGTTCCCTGTGGGGCCTGC
CTTACCCAGCTCTTCTTCTTCCATCTGTTCGTTGGAGTGGACTGCTTCCTGCTGACCGCC
ATGGCCTATGACCGATTCCTGGCCATCTGCCGGCCCCTCACCTACAGCACCCGCATGAGT
CAGACAGTCCAGAGGATGTTGGTGGCTGCGTCCTGGGCTTGTGCTTTCACCAACGCACTG
ACCCACACTGTGGCCATGTCCACGCTCAACTTCTGTGGCCCCAATGTGATCAATCACTTC
TACTGTGACCTCCCACAGCTCTTCCAGCTCTCCTGCTCCAGCACCCAACTCAATGAGCTG
CTGCTTTTTGCTGTGGGTTTTATAATGGCAGGTACCCCCATGGCTCTCATTGTCATCTCC
TATATCCACGTGGCAGCTGCAGTCCTGCGAATTCGCTCTGTAGAGGGCAGGAAGAAAGCC
TTCTCCACATGTGGCTCCCACCTCACTGTGGTTGCCATATTCTATGGTTCAGGTATCTTT
AACTATATGCGACTGGGTTCAACCAAGCTTTCAGACAAGGATAAAGCTGTTGGAATTTTC
AACACTGTCATCAATCCCATGCTGAACCCAATCATCTACAGCTTCAGAAACCCTGATGTG
CAGAGTGCCATCTGGAGGATGCTCACAGGGAGGCGGTCACTGGCT
Conceptual translation MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVRGNLSILAAVLVEPKLHT
PMYFFLGNLSVLDVGCISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLTA
MAYDRFLAICRPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNVINHF
YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPMALIVISYIHVAAAVLRIRSVEGRKKA
FSTCGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIYSFRNPDV
QSAIWRMLTGRRSLA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,195,603 3,195,603 nonsense SNP A/T */K rs7218125 (DbSNP)
17 3,195,645 3,195,645 NS C/T G/S rs16952828 (DbSNP)
17 3,195,503 3,195,503 NS C/T R/Q rs703903 (DbSNP)
17 3,195,501 3,195,501 NS G/A L/F rs56379678 (DbSNP)
17 3,195,336 3,195,336 NS G/A H/Y rs61734042 (DbSNP)
17 3,195,381 3,195,381 NS T/C M/V rs61734045 (DbSNP)
17 3,195,353 3,195,353 NS T/C N/S rs61734043 (DbSNP)
17 3,195,245 3,195,245 NS T/C D/G rs61734041 (DbSNP)
17 3,195,599 3,195,599 NS T/C H/R rs61736316 (DbSNP)
17 3,292,209 3,292,209 NS C/T R/Q 1000GP (CEU, CHBJPT)
17 100 -100 NS C/T G/D 1000GP (YRI, YRI, YRI)
17 100 -100 nonsense SNP T/A K/* 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 43 (Hasin)
17 3,192,932 3,195,976 CopyNumber #98 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

W305R R264* F254L Y221C G211D Y181H N175S M166V R125Q K92* S78G F34I A23S % Freq CORP
1 W R F Y G Y N M Q K S F A 56.61 0.796
2 W R F Y G Y N M R K S F A 39.32 0.179
3 W R F Y G Y N M R * S F A 1.08 1.200
4 W R F Y G Y N V R K S F A 0.61 0.179
5 W R F Y G H S M R * S F A 0.54 1.200
6 W R F Y D Y N M R K S F A 0.46 0.179
7 W R F Y G Y N M R K G F A 0.46 0.179
8 W R L Y G Y N M R K S F A 0.31 0.232
9 W R F Y G Y N M Q K S I A 0.23 0.796
10 W R F Y G Y N M Q K S F S 0.15 0.796
11 W * F Y G Y N M R K S F A 0.08 1.200
12 R R F Y G Y N M R K S F A 0.08 0.179
13 W R F C G Y N M R K S F A 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR3A1.aApr07-unspliced main_exon 3UTR chr17 3,291,635 3,291,638 -
CDS chr17 3,291,638 3,292,582 -