Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR3A2 Olfactory Receptor

Gene Symbol OR3A21 (View this gene in GeneCards)
Family 3
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.29 (functional)
Aliases OR17-15, OR17-228, OR17-14, HsOR17.1.10, ORL3746, ORL268
External Ids HGNC: 8283   GeneBank: AF087930, BK004239, HSU04713, NM_002551, U86244   ORDB: ORL3746, ORL268   
Build #39 labels OR3A2
Chromosomal location 17:3,277,973-3,278,917 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR3A3 90.16% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR3A1H 82% 314
Dog OR3A1 82% 314
Mouse Or3a1d 78% 314
Rat Or3a1e 77% 313
Cow OR3A2B 85% 315
Orang OR3A3 85% 315
Horse OR3A2D 84% 315
Horse OR3A2E 83% 315
Horse OR3A1 82% 314
Chimp OR3A3 84% 315
Chimp OR3A1 82% 314

Expression evidences

Source Accession
ESTs DN693319
mRNA BC095517
GNF Atlas2 221386_at

Sequence information

Nucleotide sequence ATGGAGCCAGAAGCTGGGACCAATAGGACCGCTGTTGCTGAGTTCATTCTACTGGGCCTA
GTGCAAACAGAAGAGATGCAGCCAGTTGTCTTTGTGCTCCTCCTCTTTGCCTATCTGGTC
ACAACTGGGGGCAACCTCAGCATCCTGGCAGCCGTCTTGGTGGAGCCCAAACTCCACGCC
CCCATGTACTTCTTCCTGGGGAACCTGTCAGTGCTGGATGTCGGATGTATCACTGTCACT
GTTCCTGCAATGTTGGGTCGTCTCTTGTCCCACAAGTCCACAATTTCCTATGACGCCTGC
CTCTCCCAGCTCTTCTTCTTCCACCTTCTGGCTGGGATGGACTGCTTCCTGCTGACCGCC
ATGGCCTATGACCGACTCCTGGCCATCTGCCAGCCCCTCACCTACAGCACCCGCATGAGT
CAGACAGTCCAGAGGATGTTGGTGGCTGCGTCCTTGGCTTGTGCCTTCACCAACGCACTG
ACCCACACTGTGGCCATGTCCACGCTCAACTTCTGTGGCCCCAATGAGGTCAATCACTTC
TACTGTGACCTCCCACAGCTCTTCCAGCTCTCCTGCTCCAGCACCCAACTCAATGAGCTG
CTGCTCTTTGCTGTGGGTTTCATCATGGCAGGCACACCTTTGGTTCTCATCATCACTGCC
TACAGCCACGTGGCAGCTGCAGTTCTACGAATCCGTTCAGTGGAGGGCCGAAAGAAGGCC
TTCTCCACGTGTGGCTCCCACCTCACCGTGGTTTGTCTTTTCTTTGGAAGAGGTATCTTC
AACTACATGAGACTGGGTTCAGAGGAGGCTTCAGACAAGGATAAAGGGGTTGGAGTTTTC
AACACTGTTATCAACCCTATGCTGAACCCTCTTATCTACAGCCTCAGAAACCCTGATGTT
CAGGGTGCTCTGTGGCAAATATTTTTGGGGAGGAGATCACTGACC
Conceptual translation MEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLVEPKLHA
PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA
MAYDRLLAICQPLTYSTRMSQTVQRMLVAASLACAFTNALTHTVAMSTLNFCGPNEVNHF
YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPLVLIITAYSHVAAAVLRIRSVEGRKKA
FSTCGSHLTVVCLFFGRGIFNYMRLGSEEASDKDKGVGVFNTVINPMLNPLIYSLRNPDV
QGALWQIFLGRRSLT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,181,284 3,181,284 NS A/C W/G rs61729398 (DbSNP)
17 3,182,087 3,182,087 NS A/G I/T rs62089500 (DbSNP)
17 3,181,644 3,181,644 NS C/G V/L rs61734039 (DbSNP)
17 3,181,677 3,181,677 NS C/G D/H rs73977611 (DbSNP)
17 3,181,356 3,181,356 NS C/G A/P rs61742213 (DbSNP)
17 3,181,662 3,181,662 NS C/G V/L rs9901356 (DbSNP)
17 3,181,555 3,181,555 SYN A/G T/T rs2013809 (DbSNP)
17 3,181,384 3,181,384 SYN T/C G/G rs769434 (DbSNP)
17 3,278,090 3,278,090 SYN C/T G/G 1000GP (CEU, CHBJPT)
17 3,278,261 3,278,261 SYN A/G T/T 1000GP (CEU)
17 3,277,990 3,277,990 NS C/A G/W 1000GP (CEU)
17 100 -100 SYN G/A H/H 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 41 (Hasin)
17 3,179,267 3,182,311 Deletion #242 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G316W P292A L196V % Freq CORP
1 G P L 94.64 0.203
2 G P V 3.28 0.203
3 W P L 1.20 0.203
4 G A L 0.88 0.203

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR3A2.aApr07 main_exon 3UTR chr17 3,277,693 3,277,973 -
CDS chr17 3,277,973 3,278,917 -
5UTR chr17 3,278,917 3,278,923 -
exon_5UTR chr17 3,279,076 3,279,153 -
exon_5UTR chr17 3,336,033 3,336,126 -
exon_5UTR chr17 3,383,804 3,383,899 -
exon_5UTR chr17 3,386,125 3,386,292 -
OR3A2.bApr07-unspliced main_exon 3UTR chr17 3,277,890 3,277,973 -
CDS chr17 3,277,973 3,278,917 -
5UTR chr17 3,278,917 3,278,974 -