Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR3A3 Olfactory Receptor

Gene Symbol OR3A31 (View this gene in GeneCards)
Family 3
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR17-16, OR17-16, OR17-137, OR17-137, OR17-201, OR17-201, OR5-83, OR17-22, HsOR17.1.15, ORL1015, ORL1025
External Ids HGNC: 8284   GeneBank: AF087926, AF399620, AF546420-AF546433, BC069415, BK004236, HSU04688, NM_012373, U86243, U86245, U86272   ORDB: ORL1015, ORL1025   
Build #39 labels OR3A3, OR3A8P
Chromosomal location 17:3,420,586-3,421,530 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR3A2 90.16% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR3A1H 82% 314
Dog OR3A2 81% 315
Chimp CONTIG5756.4-4361 94% 315
Mouse Or3a1d 79% 314
Rat Or3a1e 75% 313
Cow OR3A2 82% 314
Cow OR3A1D 82% 313
Cow OR3A2B 81% 315

Expression evidences

Source Accession
mRNA BC108921
GNF Atlas2 221426_s_at

Sequence information

Nucleotide sequence ATGGAGCCAGAAGCTGGGACCAATAGGACCGCTGTTGCTGAGTTCATTCTACTGGGCCTA
GTGCAAACAGAAGAGATGCAGCCAGTTGTCTTTGTGCTCCTCCTCTTTGCCTATCTGGTC
ACAACTGGGGGCAACCTCAGCATCCTGGCAGCCGTCTTGGTGGAGCCCAAACTCCACGCC
CCCATGTACTTCTTCCTGGGGAACCTGTCAGTGCTGGATGTCGGATGTATCACTGTCACT
GTTCCTGCAATGTTGGGTCGTCTCTTGTCCCACAAGTCCACAATTTCCTATGACGCCTGC
CTCTCCCAGCTCTTCTTCTTCCACCTTCTGGCTGGGATGGACTGCTTCCTGCTGACCGCC
ATGGCCTATGACCGACTCCTGGCCATCTGCCAGCCCCTCACCTACAGCACCCGCATGAGT
CAGACAGTCCAGAGGATGTTGGTGGCTGCGTCCTGGGCTTGTGCCTTCACCAACGCACTG
ACCCACACTGTGGCCATGTCCACGCTCAACTTCTGTGGCCCCAATGAGGTCAATCACTTC
TACTGTGACCTCCCACAGCTCTTCCAGCTCTCCTGCTCCAGCACCCAACTCAATGAGCTG
CTGCTCTTTGTAGCAGCAGCCTTCATGGCTGTGGCACCCTTGGTCTTCATCAGTGTGTCC
TATGCCCATGTGGTAGCTGCTGTGCTGCAAATCCGCTCTGCTGAGGGCAGAAAGAAGGCC
TTCTCCACATGTGGCTCCCACCTCACTGTGGTGGGCATCTTCTATGGGACAGGTGTCTTC
AGCTACATGAGGCTGGGTTCAGTGGAATCTTCAGACAAGGATAAGGGGGTTGGGGTTTTC
ATGACTGTGATCAACCCCATGCTGAACCCACTTATCTACAGCCTCAGAAATACTGATGTT
CAGGGCGCTCTGTGTCAGCTACTTGTGGGGAAGCGATCACTGACC
Conceptual translation MEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLVEPKLHA
PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA
MAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNEVNHF
YCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSAEGRKKA
FSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDV
QGALCQLLVGKRSLT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,324,720 3,324,720 NS A/G M/V rs12939997 (DbSNP)
17 3,324,255 3,324,255 NS C/T L/F rs769432 (DbSNP)
17 3,324,810 3,324,810 NS G/A E/K rs227787 (DbSNP)
17 3,324,334 3,324,334 NS T/G L/W rs916039 (DbSNP)
17 3,324,086 3,324,086 SYN A/G L/L rs227788 (DbSNP)
17 3,421,516 3,421,516 NS A/G K/E 1000GP (CEU, CHBJPT)
17 3,421,426 3,421,426 NS A/G M/V 1000GP (CEU)
17 100 -100 NS A/G M/V 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 219 (Hasin)
17 3,323,780 3,326,824 CopyNumber #142 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H223Q R232H M281V K311E % Freq CORP
1 H R M K 67.43 0.053
2 H R M E 28.96 0.053
3 H R V K 3.30 0.053
4 Q R M K 0.08 0.053
5 H R V E 0.08 0.053
6 H H M E 0.08 0.053
7 H H M K 0.08 0.053

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR3A3.aApr07-unspliced main_exon 5UTR chr17 3,420,568 3,420,586 +
CDS chr17 3,420,586 3,421,530 +
3UTR chr17 3,421,530 3,421,533 +