Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR3A4 Olfactory Receptor

Gene Symbol OR3A4 (View this gene in GeneCards)
Family 3
Subfamily A
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR17-16, OR17-24, OR17-13, OR17-25, HsOR17.1.12, ORL69
External Ids GeneBank: AF087920, AF087921, AF399621, BK004695, BK004725, HSU04680, NM_001005334   ORDB: ORL69   
Build #39 labels OR3A4
Chromosomal location 17:3,310,311-3,311,354 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR3A3 72.01% 293

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR3A10 71% 300
Mouse Or3a10 72% 293
Rat Or3a4 84% 293
Cow OR3A10 73% 293
Orang OR3A4P 94% 293
Horse OR3A16 73% 293
Chimp OR3A4P 95% 293

Expression evidences

Source Accession
mRNA BC136875

Sequence information

Nucleotide sequence ATGGATCTGGGGAACTCAGGGAATGATTCAGTTGTGACCAAGTTTGTCCTGCTGGGCCTC
ACAGAGACTGCAGCTCTACAGCCCATCCTCTTTGTCATCTTCCTTCTTGCTTACGTCACT
ACCATTGGAGGCACCCTCAGCATCCTGGCGGCCATCCTTATGGAAACCAAACTCCACAGC
CCCATGTACTTCTTCCTGGGGAACTTGTCCCTGCCAGATGTGGGGTGTGTCAGTGTCACT
GTCCCTGCCATGCTGAGCCATTTCATATCCAACGACAGAAGCATTCCCTATAAGGCCTGC
CTCTCCGAGCTCTTCTTCTTCCACCTCCTGGCTGGGGCAGACTGCTTCTTGCTGACCATC
ATGGCCTATGACCGCTATCTGGCCATCTGCCAGTCCCTCACCTACAGCAGCCGCATGAGC
TGGGGAATCCAGCAAGCCCTGGTGGGCATGTCATGTGTCTTTTCCTTCACCAATGCACTG
ACCCAAACTGTTGCCCTGTCTCCTCTTAACTTCTGTGGCCCCAATGTGATCAATCACTTC
TACTGTGACCTCCCACAGCCCTTCCAGCTCTCCTGCTCCAGTGTTCATCTCAATGGGCAG
TTGCTGTTTGTAGCAGCAGCTTTCATGGGTGTGGCCCCCTTGGTCCTCATCACTGTGTCC
TATGCCCATGTGGCAGCTGCAGTCCTGCGAATCCGCTCTGCAGAGGGCAGAAAGAAAGCC
TTCTCCACGTGTAGTTCCCACCTCACTGTGGTGGGCATCTTCTATGGGACGGGCGTCTTC
AGCTACACAAGGCTGGGTTCAGTGGAGTCTTCGGACAAGGACAAGGGCATTGGCATCCTC
AACACTGTCATCAGCCCCATGCTGAACCCACTCATCTACTGGACATCTCTGCTGGACGTC
GGGTGCATCAGTCACTGTTCCTCCGATGCTGGCGTGTCTCCAGGCCCACCAGTGCAGAGT
TCCCTATGCTGCCTGCAGTTCACAGCTCTTCTTTCCCCACCTCCTGGCTGGGGTGGACTG
TCACCTCTTAATAGCCATGGCCTA
Conceptual translation MDLGNSGNDSVVTKFVLLGLTETAALQPILFVIFLLAYVTTIGGTLSILAAILMETKLHS
PMYFFLGNLSLPDVGCVSVTVPAMLSHFISNDRSIPYKACLSELFFFHLLAGADCFLLTI
MAYDRYLAICQSLTYSSRMSWGIQQALVGMSCVFSFTNALTQTVALSPLNFCGPNVINHF
YCDLPQPFQLSCSSVHLNGQLLFVAAAFMGVAPLVLITVSYAHVAAAVLRIRSAEGRKKA
FSTCSSHLTVVGIFYGTGVFSYTRLGSVESSDKDKGIGILNTVISPMLNPLIYWTSLLDV
GCISHCSSDAGVSPGPPVQSSLCCLQFTALLSPPPGWGGLSPLNSHGL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,214,106 3,214,106 NS A/C T/P rs9911226 (DbSNP)
17 3,214,544 3,214,544 NS A/C T/P rs62089558 (DbSNP)
17 3,213,962 3,213,962 NS A/G I/V rs9906179 (DbSNP)
17 3,214,314 3,214,314 NS A/G K/R rs231677 (DbSNP)
17 3,213,728 3,213,728 NS A/G I/V rs9905684 (DbSNP)
17 3,214,502 3,214,502 NS A/G I/V rs8076130 (DbSNP)
17 3,214,299 3,214,299 NS A/G H/R rs61734049 (DbSNP)
17 3,214,128 3,214,128 NS A/G N/S rs9912090 (DbSNP)
17 3,213,862 3,213,862 NS C/G S/R rs9905086 (DbSNP)
17 3,213,911 3,213,911 NS C/G Q/E rs9903671 (DbSNP)
17 3,213,690 3,213,690 NS C/T T/I rs61734050 (DbSNP)
17 3,214,181 3,214,181 NS G/T A/S rs231678 (DbSNP)
17 3,214,145 3,214,145 NS T/C Y/H rs2855677 (DbSNP)
17 3,214,546 3,214,546 SYN A/T P/P rs60532712 (DbSNP)
17 3,213,892 3,213,892 SYN C/G P/P rs41425144 (DbSNP)
17 3,213,841 3,213,841 SYN C/T V/V rs61734052 (DbSNP)
17 3,213,835 3,213,835 SYN C/T V/V rs60491901 (DbSNP)
17 3,213,994 3,213,994 SYN C/T C/C rs57698364 (DbSNP)
17 3,310,887 3,310,887 NS T/G S/A 1000GP (CEU, CHBJPT)
17 3,311,020 3,311,020 NS G/A R/K 1000GP (CEU)
17 3,310,617 3,310,617 NS G/C E/Q 1000GP (CEU)
17 3,310,568 3,310,568 NS C/G S/R 1000GP (CEU)
17 3,310,834 3,310,834 NS A/G N/S 1000GP (CEU)
17 3,310,396 3,310,396 NS T/C I/T 1000GP (CEU, CHBJPT)
17 3,310,812 3,310,812 NS C/A P/T 1000GP (CEU)
17 3,310,434 3,310,434 NS A/G I/V 1000GP (CEU)
17 3,310,668 3,310,668 NS A/G I/V 1000GP (CEU)
17 3,311,208 3,311,208 NS G/A V/I 1000GP (CHBJPT)
17 100 -100 NS A/G I/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
17 100 -100 SYN C/T V/V 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 44 (Hasin)
17 3,213,505 3,216,648 CopyNumber #99 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I29T I42V V81I S86R E103Q T119S I120V R125H P168T N175S Y181H S193A R237K V300I % Freq CORP
1 I I V S E T I R P N Y S R V 39.02 1.000
2 I I V S E T I R P N Y A R V 26.34 1.000
3 T I V S E T I R P N Y A R V 10.52 1.000
4 I V V R Q T V R T S Y S R V 9.06 1.000
5 I V V R Q T V R T S Y S R I 4.92 1.000
6 I V V R Q T V R T N H S R V 2.76 1.000
7 I I V S E T I R P N Y A K V 2.15 1.000
8 I V V R Q T V R T S Y S K I 0.77 1.000
9 I V V R Q T V R T S Y A K I 0.38 1.000
10 I V V R Q T I R T S Y S R V 0.38 1.000
11 I I V S E T I R P N H S R V 0.38 1.000
12 I I V S E T I H P N Y S R V 0.31 1.000
13 T I V S E T I R P N Y S R V 0.31 1.000
14 I I V S E T I R P N Y S R I 0.23 1.000
15 I I V S E T V R T S Y S R V 0.23 1.000
16 I V V R Q T V R T N Y A R V 0.15 1.000
17 I V V R Q T I R P S Y S R V 0.15 1.000
18 I I V S E T I R P S Y A R V 0.15 1.000
19 I V V S E T I R P N Y S R V 0.15 1.000
20 I V V R Q T I R P N Y A R V 0.15 1.000
21 I V V R Q T V R T S Y A R V 0.15 1.000
22 I I V R Q T I R P N Y S R V 0.08 1.000
23 I I V S Q T V R T S Y S R V 0.08 1.000
24 I V V R Q T V H T S Y S R I 0.08 1.000
25 I I V R Q T I R P N Y A R V 0.08 1.000
26 I V V R Q T V R T S Y A R I 0.08 1.000
27 I V V S E T I R T S Y S K V 0.08 1.000
28 I I V R E T I R T S Y S R V 0.08 1.000
29 I V V R Q T V R P N Y S R V 0.08 1.000
30 I V V S E T V R T S Y S R I 0.08 1.000
31 I I I S E T I R P N Y A R V 0.08 1.000
32 I V I R Q T I R P N Y A R V 0.08 1.000
33 I V V S E T I R T S Y S R V 0.08 1.000
34 I I V S E S I R P N Y S R V 0.08 1.000
35 I I V R E T I R T N Y A R V 0.08 1.000
36 I I V S E T I R T S Y S R I 0.08 1.000
37 I V V R Q T V R T N H A R V 0.08 1.000
38 I V V S Q T V R T N Y A R V 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR3A4.aApr07-unspliced main_exon 5UTR chr17 3,309,986 3,310,311 +
CDS chr17 3,310,311 3,311,354 +
3UTR chr17 3,311,354 3,311,357 +