Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR3B1P Olfactory Receptor

Gene Symbol OR3B1P1 (View this gene in GeneCards)
Family 3
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases HsORX.2.1P, ORL4077
External Ids HGNC: 14839   GeneBank: NG_004382   ORDB: ORL4077   
Build #39 labels OR3B1P
Chromosomal location X:154,658,733-154,659,661 (-)
Cluster X@77
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR3A1 40.77% 287
OR3A3 42.01% 288
OR3A4 39.79% 284

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR3A1H 43% 288
Mouse Or3a1d 43% 293
Rat Or3a1f 42% 300
Cow OR3A1 42% 292
Orang OR3A3 41% 288
Horse OR3A2D 43% 289
Chimp OR3A3 42% 293

Sequence information

Nucleotide sequence TCTGTGCGTGGTTCCAAGCAGCTGCGGAATGGGACCCTAGTGTCCCAGTTTCTTCTGAAA
GGCCTGAGGGACAGCAAGGCTTGGAGGCCCCTGCTGTTCACCACCTTTCTGCTAATCTAC
ATAGTGGTTGTGGTTGGGAGCCACATGTTCACAGTGGACTACCGACGCCACACTCCCATG
TACTTCTTCTTGGGCGGCCACTCGCTGATGGATGCCGCCTGTATCTCCAACATGGTGACT
CAGGTGCTGGTGCATTTGCTGGCTCCGGTAGGGCCCGTACTTTATTGTGCTTGTCTCATC
CAGATATGCTTTCTCCACTTCCTGGCACCCTAGGAGTCCTTCCTCCTCACAGCCGTGGCC
TATGATTCTATGCAGCTATCTGCCAGCCATTGCACTACTTTGTCCTCGTGGGCCGACTGA
CCCACACGGGCCTCACTTCCATCTCCTGCCTGCTGGCCTTGGCCAACGCATTCACCTACA
GCATCCTCACAGCTCTACCCAAGTTCTGCAGGCCTTGCCTCATCACCCACTTCTTCTGCG
ACCTCCGTCACTGCTCAGACTCTCTTGCTTCAGCACACGTACCAATGAACTTGCCCTGTT
CTTCAGTTTTCTGGTGGCTCTTGCACACTGCGTCCTGGTCGTGGTCTCCTATGGACACGT
TGTGGCTGCTGTTCAGGATTCATTCCACCCAGGGCTGAAGAAAAGCCTTTTCTACCTGTG
TTGCCCATCTCGCTATGATCGGTCTTTTCTACGTCACTTCAGTCCCCTGCTACATCCTTC
CCAACTCTGCATACTCTGGCTTGGGCGACTGGGTGCTCTCTGTGCTATGTGTGGTCCTCA
CTCACATGCTAAACCCCATCTTCCCCAGCATGCTGGGATGACAGGCATGAGCCACCGCAC
CGGCCAGGAAATATTTCTTGAAAGAAAGA
Conceptual translation SVRGSKQLRNGTLVSQFLLKGLRDSKAWRPLLFTTFLLIYIVVVVGSHMFTVDYRRHTPM
YFFLGGHSLMDAACISNMVTQVLVHLLAPVGPVLYCACLIQICFLHFLAPXSFLLTAVA
YDSM/AICQPLHYFVLVGRLTHTGLTSISCLLALANAFTYSILTALPKFCRPCLITHFF
CD/PSLLRLSCFSTRTNELALFFSFLVALAHCVLVVVSYGHVVAAVQ\HSTQGXKAF
STCVAHLAMIGLFYVTSVPCYILPNSAYSGLGDWVLSVLCVVLTHMLNPIFPSMLGXAXbr/>ATAPARKYFLKER

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
X 153,887,062 153,887,061 Ins(1) -/C rs35814060 (DbSNP)
X 153,887,204 153,887,204 SNP C/T rs5945222 (DbSNP)
X 153,887,670 153,887,670 SNP G/T rs5945223 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 240 (Hasin)
X 153,885,007 153,888,035 Deletion #315 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.