Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A11P Olfactory Receptor

Gene Symbol OR4A11P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.11.1P, ORL3591
External Ids HGNC: 15148   GeneBank: NG_004332   ORDB: ORL3591   
Build #39 labels OR4A11P
Chromosomal location 11:55,318,560-55,319,477 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A13P 82.78% 302
OR4A40P 85.33% 300
OR4A45P 83.22% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 76% 299
Mouse Or4a39 77% 302
Rat Or4a77c 73% 303
Cow OR4A2 70% 299
Orang OR4A47P 65% 302
Horse OR4A124 74% 303
Chimp OR4A40CP 85% 306
Chimp OR4A40BP 86% 302
Chimp OR4A13P 85% 302

Sequence information

Nucleotide sequence ATGAGACAGAATAACAGTAGTACAGAATTTGTTCTCCTGGGCTTTTCTCAGGATCCTGAT
GTGCAAAATGCGCTATTTGTCATGTTTTTACTGACATACATTGTGACAATGGTGGGGAAC
CTACTCATTGTGGTGACTATTATTGCCAGCCCTTCCTTGGGCTCCCCAATGTACTTTTTC
CTTGCCCACCTGTCATTTATAGATGCTGTGTATTCCACCACCATTTCTCCTGTATTGATT
GTAGACTTACTCTGTGACAAAAAGACGATTTCCTTCTGAGCTTGCATGGGACAACTGTTT
ATAGACCACTTATTTGGTGGTTCTGAGGTCTTCCTTCTGGTGGTGATGGCCTGTGATCGC
TGTGTGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAATCGACAGGTTTGCATT
CTTCTCTTGGTGTTGGCTGTGACTGGAGGTTTTGTGCATCCTGTATTTCAAGTTGTTGTT
GTGTACAGTCTCCCTTTCTGTGGCCCCAATGTCATTGACCACTTTTTCTGTGACATATAC
CCTTTATTTGGAACTGGCATGCACTGACACCTACTTTATAGGCCTCACTGTGGTTTTCAA
TGGTGGAGCAATGCGTATGGTCATCCTCACCCTTCTACTAGTCTTCTATGGAGTCATCCT
AAACTCCCTTAAAACTTACAGTCAGGAAGGGAGGCATAAAGCCCTGTCTACCTGCAGCTC
CCATTTTACCGTGGTTATCTTGTTTTTTGCTTCCTGTATTTTCATATATGTTAGACCTGT
TTCAAATTTTCTGTTGATAAATTCATGACTGTGTTTTATACGGTTATCACACCCATGTTG
AATCCTTTTATATGCATGTTGAGAAATTCAGAGATGAGAAATGCTATAGAAAAACTCCTG
TGTAAAATGAACTGTAGT
Conceptual translation MRQNNSSTEFVLLGFSQDPDVQNALFVMFLLTYIVTMVGNLLIVVTIIASPSLGSPMYFF
LAHLSFIDAVYSTTISPVLIVDLLCDKKTISFXCMGQLFIDHLFGGSEVFLLVVMACDR
CVAICKPLHYLTIMNRQVCILLLVLAVTGGFVHPVFQVVVVYSLPFCGPNVIDHFFCDIY
PL\ELACTDTYFIGLTVVFNGGAMRMVILTLLLVFYGVILNSLKTYSQEGRHKALSTCS
SHFTVVILFFASCIFIYVRPVSNF/VDKFMTVFYTVITPMLNPFICMLRNSEMRNAIEK
LLCKMNCS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/T 1000GP (YRI, YRI, YRI, YRI)
11 55,086,267 55,086,267 SNP G/T rs72480331 (DbSNP)
11 55,086,293 55,086,293 SNP C/T rs1216159 (DbSNP)
11 55,086,384 55,086,384 SNP A/G rs72480347 (DbSNP)
11 55,086,394 55,086,394 SNP G/A rs72486118 (DbSNP)
11 55,086,595 55,086,595 SNP G/T rs56073637 (DbSNP)
11 55,086,760 55,086,760 SNP G/T rs1216160 (DbSNP)
11 55,318,600 55,318,600 SNP G/T 1000GP (CEU)
11 55,318,817 55,318,817 SNP C/T 1000GP (CEU, CHBJPT)
11 55,318,884 55,318,884 SNP G/A 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,083,434 55,156,434 CopyNumber Variation_48825 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.