Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A16 Olfactory Receptor

Gene Symbol OR4A161 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-117, HsOR11.11.3, ORL3439
External Ids HGNC: 15153   GeneBank: AB065519, BK004249, NM_001005274   ORDB: ORL3439   
Build #39 labels OR4A16
Chromosomal location 11:55,343,201-55,344,184 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A13P 73.08% 312
OR4A1P 72.96% 307
OR4A40P 72.91% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 74% 307
Chimp CONTIG1280.44-9696 95% 328
Mouse Or4a39 74% 311
Rat Or4a69 74% 299
Cow OR4A2 69% 303

Expression evidences

Source Accession
mRNA BC140748

Sequence information

Nucleotide sequence ATGAGACCAAGCAGCAATGTTACAGAATTTGTCCTCCTGGGCCTCACTCAAGATCCTGAT
GTGAAAAAAACATTATTTGTCATGTTTTTACTCATATACATTGTGACAATGGTGGGAAAC
CTCCTCATTTGGGTGACTACTATTGGCAGCCCCTCCTTGGGCTCCCTAATGTACTTCTTC
CTTGCCTACTTGTCACTTATGGATGCCATATATTCCACTGCCATGTCACCCAAATTGATG
ATAGACTTACTCTGTGATAAAATCGCTATTTCCTTGTCAGCTTGCATGGGTCAGCTCTTC
ATAGAACACTTACTTGGTGGTGCAGAGGTCTTCCTTTTGGTGGTGATGGCCTATGATCGC
TATGTGGCTATCTCTAAGCCGCTGCACTATTTGAACATCATGAATCGACTGGTTTGCATC
CTTCTGTTGGTGGTGGCCATGATTGGAGGTTTTGTGCACTCTGTGGTTCAAATTGTCTTT
CTGTACAGTCTACCAATCTGTGGCCCCAATGTTATTGACCACTCTGTCTGTGACATGTAC
CCATTGTTGGAACTGTTGTGCCTTGACACCTACTTTATAGGACTCACTGTGGTTGCCAAT
GGTGGAATAATTTGTATGGTCATCTTTACCTTTCTGCTAATCTCCTGTGGAGTCATCCTA
AACTTCCTTAAAACTTACAGTCAGGAAGAGAGGCATAAAGCCCTGCCTACCTGCATCTCC
CACATCATTGTGGTTGCCCTCGTTTTTGTTCCCTGTATTTTTATGTATGTTAGACCCGTT
TCCAACTTTCCCTTTGATAAATTAATGACTGTGTTTTATTCAATTATCACACTCATGTTG
AATCCTTTAATATACTCGTTGAGACAATCAGAGATGAAAAATGCTATGAAAAATCTCTGG
TGTGAAAAGTTAAGTATAGTTAGAAAAAGAGTATCTCCCACACTGAACATATTTATTCCT
AGTTCTAAGGCAACAAATAGGCGG
Conceptual translation MRPSSNVTEFVLLGLTQDPDVKKTLFVMFLLIYIVTMVGNLLIWVTTIGSPSLGSLMYFF
LAYLSLMDAIYSTAMSPKLMIDLLCDKIAISLSACMGQLFIEHLLGGAEVFLLVVMAYDR
YVAISKPLHYLNIMNRLVCILLLVVAMIGGFVHSVVQIVFLYSLPICGPNVIDHSVCDMY
PLLELLCLDTYFIGLTVVANGGIICMVIFTFLLISCGVILNFLKTYSQEERHKALPTCIS
HIIVVALVFVPCIFMYVRPVSNFPFDKLMTVFYSIITLMLNPLIYSLRQSEMKNAMKNLW
CEKLSIVRKRVSPTLNIFIPSSKATNRR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/G L/V 1000GP (YRI, YRI, YRI)
11 55,111,222 55,111,222 SYN A/G L/L rs7121804 (DbSNP)
11 55,111,238 55,111,238 NS A/C I/L rs11229158 (DbSNP)
11 55,111,371 55,111,371 NS A/G H/R rs12807769 (DbSNP)
11 55,111,584 55,111,584 NS A/T K/M rs10896659 (DbSNP)
11 55,343,212 55,343,212 SYN C/T S/S 1000GP (CEU)
11 55,343,239 55,343,239 SYN G/A L/L 1000GP (CEU)
11 55,343,389 55,343,389 SYN C/T Y/Y 1000GP (CEU)
11 55,343,401 55,343,401 NS G/A M/I 1000GP (CEU)
11 55,343,427 55,343,427 nonsense SNP C/A S/* 1000GP (CEU)
11 55,343,681 55,343,681 NS C/G L/V 1000GP (CEU)
11 55,343,696 55,343,696 NS A/T I/F 1000GP (CEU)
11 55,343,746 55,343,746 SYN G/A L/L 1000GP (CEU)
11 55,343,762 55,343,762 NS C/A L/I 1000GP (CEU, CHBJPT)
11 55,343,977 55,343,977 SYN C/T P/P 1000GP (CEU)
11 55,344,004 55,344,004 NS A/C L/F 1000GP (CEU)
11 55,344,020 55,344,020 NS T/A S/T 1000GP (CEU)
11 55,344,024 55,344,024 NS T/C I/T 1000GP (CEU)
11 55,344,033 55,344,033 NS T/C L/P 1000GP (CEU)
11 55,344,108 55,344,108 NS A/T K/M 1000GP (CEU, CHBJPT)
11 55,344,126 55,344,126 NS A/T K/I 1000GP (CEU)
11 55,344,131 55,344,131 NS G/T V/L 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,083,434 55,156,434 CopyNumber Variation_48825 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M67I S76* L105V L161V I166F L188I L268F S274T I275T K303M % Freq CORP
1 M S L L I L L S I K 50.38 1.000
2 M S L L I I L S I M 43.78 1.000
3 M S L L I L L S T K 1.23 1.000
4 M S V L I L L S I K 1.00 1.000
5 M S L V F L F T I K 0.61 1.000
6 I * L V F L F S I K 0.54 1.200
7 M S L V F L L S I K 0.46 1.000
8 M S L L I I L S I K 0.31 1.000
9 I * L V F L F T I K 0.31 1.200
10 M S L V F L F S I K 0.31 1.000
11 I * L V I L L S I K 0.23 1.200
12 I S L V F L F T I K 0.15 1.000
13 I * L V F L L S I K 0.15 1.200
14 M S L L I L L S I M 0.15 1.000
15 M * L V F L F T I K 0.08 1.200
16 I S L L I I L S I M 0.08 1.000
17 M S L V I L L S I K 0.08 1.000
18 I * L L I L F S I K 0.08 1.200
19 M S L L I L F S I K 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4A16.aApr07-unspliced main_exon CDS chr11 55,343,201 55,344,184 +
3UTR chr11 55,344,184 55,344,187 +