Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A1P Olfactory Receptor

Gene Symbol OR4A1P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-30, HsOR11.9.1P, ORL3651
External Ids HGNC: 8289   GeneBank: AF065869, NG_002173   ORDB: ORL3651   
Build #39 labels OR4A1P, OR4A20P
Chromosomal location 11:49,898,264-49,899,186 (-)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A11P 82.12% 302
OR4A13P 79.8% 307
OR4A40P 82.67% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 75% 302
Chimp CONTIG2667.1-2030 81% 307
Chimp CONTIG2342.6-10712 82% 306
Chimp CONTIG1280.31-3335 80% 302
Mouse Or4a39 73% 305
Rat Or4a81 72% 304
Cow OR4A2 68% 303

Sequence information

Nucleotide sequence ATGAGACAGAATAATAATATTACAGAATTTGTCCTCCTGGGCTTCTCTCAGGATCTGGAT
GTGCAAAAAGCATTATTTGTCATATTTTTACTCACATACTTGGTGACAGTGGTGGGGAAC
CTGCTCATTGTGGTGACTATTATTGCCAGCCCTTCCTTGGGCTCCTCAATGTACTTCTTC
CTTGCCTGCCTGTCATTTATAGATGCTGCATATTCCACTACAATTTCTCCCAAATTGATT
GTAGACTTACTCTGTGATAAAAAGACTATTTCTTTCCCAGCTTGCATGGGCCAGTTATTT
ATATACCACTTGTTTGGTGGTTCTGAGGTCTTCCTTCTTGTGGTGATGGCCTGTGATCAC
TATGTGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAATCGACAGGTTTGAATC
CTTCTGTTGGTGGTGGTCGTGACTGGAGGTTTTCTGCATTCTGTGTTTCAAATTGTTGTT
GTATACAGTCTCGCTTTCTGTGGCCCCAATGTCATTGACTACTTTGTCTGTGACATGTAC
CCATTATTGGAACTGGTATGCACTGACACCTACTTTATTGGCCTTACTGTTTTTGTCAAT
GGTGGAACAATCTGTATAGTCGTCTTCACCCTTCTACTAATCTCCTATGGAGTCATCCTA
AACTCCCTTAAAACTTACAGTCAAGAAGGGAGGCATAAAGTCCTGTTTACCTGCAGCTCC
CACATTATCGTCTTTGCCCTCTTTTTTGTTCCCTGTATTTTCATGTATGTTAGACCTGTT
TCAAACATCCTTTTGATAAATTCCTGACAGTGTTTTATACAGTTATCACACCCATGTTGA
ATCCTTTAATATACACATTGAGAAATTCAGAGATGAGAAATTCTGTAGAAACACTCTTGT
GTAAAAAGTTAACTGTATTAGAG
Conceptual translation MRQNNNITEFVLLGFSQDLDVQKALFVIFLLTYLVTVVGNLLIVVTIIASPSLGSSMYFF
LACLSFIDAAYSTTISPKLIVDLLCDKKTISFPACMGQLFIYHLFGGSEVFLLVVMACDH
YVAICKPLHYLTIMNRQVXLLLVVVVTGGFLHSVFQIVVVYSLAFCGPNVIDYFVCDMY
PLLELVCTDTYFIGLTVFVNGGTICIVVFTLLLISYGVILNSLKTYSQEGRHKVLFTCSS
HIIVFALFFVPCIFMYVRPVSN/PFDKFLTVFYTVITPMLNPLIYTLRNSEMRNSVETL
LCKKLTVLE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI)
11 49,898,505 49,898,505 SNP G/A 1000GP (CEU)
11 49,919,836 49,919,836 Del(1) -/T rs34625441 (DbSNP)
11 49,920,573 49,920,573 SNP G/A rs847638 (DbSNP)
11 49,920,594 49,920,594 SNP C/T rs847637 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)
11 49,823,034 49,922,563 CopyNumber Variation_85773 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.