Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A21P Olfactory Receptor

Gene Symbol OR4A21P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-124, HsOR11.11.12P, ORL3652
External Ids HGNC: 15158   GeneBank: AB065772, BK004755, NG_004238   ORDB: ORL3652   
Build #39 labels OR4A21P
Chromosomal location 11:55,491,156-55,492,145 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A15 90.58% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A15 80% 313
Chimp CONTIG1280.45-14113 88% 330
Mouse Or4a15 82% 310
Rat Or4a15 82% 301
Cow OR4A15P 80% 306

Sequence information

Nucleotide sequence TTTTGTTTACAGGTTCTGACACCTTAGTCCAATACCTTCAGAAGAACACATGGAAAATAG
GAAAAATTGACTTAATTCATCCTCTTGGGGCTCACACAGAACCCTGAGGGCCAAAAAGTT
TTATTTGTCACATTCTTACTCATCTACATTGTGACGATAATGGGCAACCTCCTTATCATG
GTGACCATCATGGCCAGCCAGTCCCTGGGTTCCCCCATGTACTTTTTTCTGGCTTCTTTA
TCATTTATACATACCGTCTATTATACTGCCATTGCTCCCAAAATGATTGTTGACCTGCTC
TCTGAGAAAAAGACCATTTCTTTTCAGGGTTGTATGGCTCAACTTTTTATGGATCATTTA
TTTGCTGGTGCTGAAGTCATTCTTCTGGTGGTAATGGCCTATGATCAATATGTGGCCATC
TGTAAGCCTCTTCATTATTTGATCATCATGAATTGTCGAGTCTGTGTTCTCATGCTGTTG
GTGGCCTGGATTGGAGGCTTTCTTCACTCATTGGTTCAATTTCTCTTTATTTATCAGCTC
CCTTTCTGTGGACCCAATGTCATTGACAACTTCCTGTGTGATTTGTATCCCTTATTGAAA
CTTGCTTGCACCAATACCTATGTCACTGGGCTTTCTATGATAGCTAATGGTGGAGCGATT
TGTACTGTCACCTTCTTCCCTCTCCTGCTTTCCTATGGGGTCATATTACCCTCTCTTAAG
ACTCAGAGTTTGGAAGGGAAATGCAAAGCTTTCTACACCTGTGCATCCCACATCACTGTG
ATCACTTTATTCTTTGTCCCCTGCATCTTCCTGTTTGCAAGGCCCAACTCCACCTTTCCC
ATTGATAAATCCATGACTGTGGTTTTAACTTGTATAACTCCCATGCTGAAACCACTAATC
TATGCCCTGAGGAATGCAGAAATGAAAAGTGCCATGAGGAAACTTTGGAGTGAAAAAGTA
AGCTTAGCTGGAAAAGGGCTGTATCCCTCA
Conceptual translation FCLQVLTPXNTFRRTHGKXKLTXILLGLTQNPEGQKVLFVTFLLIYIVTIMGNLLIM
VTIMASQSLGSPMYFFLASLSFIHTVYYTAIAPKMIVDLLSEKKTISFQGCMAQLFMDHL
FAGAEVILLVVMAYDQYVAICKPLHYLIIMNCRVCVLMLLVAWIGGFLHSLVQFLFIYQL
PFCGPNVIDNFLCDLYPLLKLACTNTYVTGLSMIANGGAICTVTFFPLLLSYGVILPSLK
TQSLEGKCKAFYTCASHITVITLFFVPCIFLFARPNSTFPIDKSMTVVLTCITPMLKPLI
YALRNAEMKSAMRKLWSEKVSLAGKGLYPS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,258,709 55,258,709 SNP A/C rs61919683 (DbSNP)
11 55,258,823 55,258,823 SNP A/G rs61747878 (DbSNP)
11 55,258,924 55,258,924 SNP A/G rs17157421 (DbSNP)
11 55,259,484 55,259,484 SNP A/T rs17157424 (DbSNP)
11 55,258,881 55,258,881 SNP C/G rs17494249 (DbSNP)
11 55,258,726 55,258,726 SNP C/G rs17158628 (DbSNP)
11 55,259,016 55,259,016 SNP C/T rs34847108 (DbSNP)
11 55,259,113 55,259,113 SNP C/T rs61730927 (DbSNP)
11 55,259,583 55,259,583 SNP G/A rs531971 (DbSNP)
11 55,259,085 55,259,085 SNP T/C rs556754 (DbSNP)
11 55,259,384 55,259,384 SNP T/C rs2034987 (DbSNP)
11 55,491,233 55,491,233 SNP C/A 1000GP (CEU)
11 55,491,405 55,491,405 SNP C/G 1000GP (CEU)
11 55,491,609 55,491,609 SNP T/C 1000GP (CEU, CHBJPT)
11 55,491,860 55,491,860 SNP A/G 1000GP (CEU)
11 55,492,107 55,492,107 SNP G/A 1000GP (CEU)
11 55,491,911 55,491,911 SNP C/T 1000GP (CHBJPT)
11 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,183,726 55,258,691 CopyNumber Variation_6922 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.