Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A41P Olfactory Receptor

Gene Symbol OR4A41P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.8.19P
External Ids HGNC: 31260   GeneBank: NG_004413   
Build #39 labels
Chromosomal location 11:48,589,739-48,590,690 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A44P 79.68% 315
OR4A6P 80.83% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 67% 310
Mouse Or4a39 69% 312
Rat Or4a77e 68% 313
Cow OR4A2 63% 311
Orang OR4A47P 60% 307
Horse OR4A124 69% 307
Chimp OR4A44P 79% 310

Sequence information

Nucleotide sequence AGAGAAGAGTAAAGGGGACTGAGTAACAATGTTACAGGATTTGTCCTCTTGGGCAACACT
CAGGATCCTGATGTGCAAAATGCATTATTTGTCATGGTTTTACTCACATACATTGTGACT
ACAGTGGGGAACCTGCTCATTGTGGTGGCTATTATTGCCAGTCCCTCCTTGGGCTCCCCA
ATATACTTCTTCCTTGTCTGCCTGTCATTTATAGATGCTGCATATTCCACAGCCATTTGT
CCCAAATTGACTGTAGAGTTACTCCATGACAAAAAGACTATTTTCTTCACAGCATGCATG
GGGCAGCTATTTAAAGACCACTTATTTGGTGGTGCTGAGGTCTTCCTACTGGTGGGGATG
GTCTATGATCGCTATGTGGCCGACTGTAAGCCACTGCACTATTTTACCATCATGAATCGA
CAGGTTTGCATCCTTCTCTTGCTGATGGCTGTGACTGGAGGTTTTATGAATTCTGTGTTT
CAAATTGTTGTGTACAATCTCCCTTTCTGTGGTGCCAGTGTCACTGACCACTTTGTCTGT
GACGTGTACCCATTATTGGAACTGGCGTGCACTGATACCTACTTTATAGGCCTCACTGTT
GTGGCCAGTGGTGGAGCTATGTGTATGTTTGTCTTCACCCTTCTGCTAATCTCCTATGGA
GTCATTCTAGTTTAGGTAGTTTACCTTAAAACTTACAGTCAGGAAGGGAGGTGTAAAACC
TTCTCTGCCTGCATCTCCTGCATCACTGTGGTTGTCCTGTTTTTAGTTCCCTGATTTTCC
TGTTTGTTAGACCTGTTTTGAACTTTCCTATTGATAAATTCATGACTGTGTTTTATACAG
TTATCACACACCCATGTTGAATTCATTAATATACACACTGAGAAATGTAGAGATGAGAAT
TGCTGTAAAAACCAATGTAAAAAAACTCTGGCATAAAAACTAAACTATAGTT
Conceptual translation REEXGLSNNVTGFVLLGNTQDPDVQNALFVMVLLTYIVTTVGNLLIVVAIIASPSLGSP
IYFFLVCLSFIDAAYSTAICPKLTVELLHDKKTIFFTACMGQLFKDHLFGGAEVFLLVGM
VYDRYVADCKPLHYFTIMNRQVCILLLLMAVTGGFMNSVFQIVVYNLPFCGASVTDHFVC
DVYPLLELACTDTYFIGLTVVASGGAMCMFVFTLLLISYGVILVXVYLKTYSQEGRCKT
FSACISCITVVVLFLVP/IFLFVRPVLNFPIDKFMTVFYTVIT/PMLNSLIYTLRNVE
MRIAVKTNVKKLWHKNXIV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 48,589,848 48,589,848 SNP A/G 1000GP (CEU, CHBJPT)
11 48,589,895 48,589,895 SNP G/T 1000GP (CHBJPT)
11 48,590,067 48,590,067 SNP G/C 1000GP (CEU)
11 48,590,099 48,590,099 SNP G/A 1000GP (CEU, CHBJPT)
11 48,590,408 48,590,408 SNP G/A 1000GP (CHBJPT)
11 48,590,417 48,590,417 SNP G/C 1000GP (CEU, CHBJPT)
11 48,590,436 48,590,436 SNP G/T 1000GP (CEU, CHBJPT)
11 48,590,472 48,590,472 SNP T/A 1000GP (CEU, CHBJPT)
11 48,590,488 48,590,488 SNP G/A 1000GP (CEU)
11 48,590,503 48,590,503 SNP A/T 1000GP (CEU, CHBJPT)
11 48,590,511 48,590,511 SNP G/C 1000GP (CEU, CHBJPT)
11 48,611,400 48,611,400 SNP A/G rs10838972 (DbSNP)
11 48,611,440 48,611,440 SNP C/T rs73470655 (DbSNP)
11 48,611,619 48,611,619 SNP C/G rs72904693 (DbSNP)
11 48,611,651 48,611,651 SNP A/G rs11039858 (DbSNP)
11 48,611,924 48,611,924 SNP G/T rs72904694 (DbSNP)
11 48,611,960 48,611,963 Del(4) -/GTTT rs57981298 (DbSNP)
11 48,611,960 48,611,968 Del(9) -/GTTTAGGTA rs67994309 (DbSNP)
11 48,611,965 48,611,967 Del(3) -/GGT rs61661645 (DbSNP)
11 48,611,969 48,611,969 SNP C/G rs59203322 (DbSNP)
11 48,611,971 48,611,979 In-Del(9) -/AACTACCTA rs71948196 (DbSNP)
11 48,611,972 48,611,973 In-Del(2) -/AA rs61397477 (DbSNP)
11 48,611,988 48,611,988 SNP G/T rs11039859 (DbSNP)
11 48,612,024 48,612,024 SNP A/T rs6485891 (DbSNP)
11 48,612,055 48,612,055 SNP A/T rs10838973 (DbSNP)
11 48,612,063 48,612,063 SNP C/G rs12278284 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,479,497 48,689,328 CopyNumber Variation_5013 (DGV)
11 48,611,191 48,614,242 Deletion #210 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.