Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A44P Olfactory Receptor

Gene Symbol OR4A44P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.8.21P
External Ids HGNC: 31263   GeneBank: NG_004415-NG_004417   
Build #39 labels
Chromosomal location 11:48,627,480-48,628,460 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A6P 91.69% 325

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 69% 306
Chimp CONTIG2342.7-14206 98% 328
Mouse Or4a39 70% 307
Rat Or4a74 66% 306
Cow OR4A2 64% 308

Sequence information

Nucleotide sequence TTACAGGTCCTGTTCTCCTGAGCTCTCAACTGTGACAGAAGCCTTAGAGAAGAGTAAAGG
GGACTGAGTAATAATATTACAGAATTTGTCCTCTTGGGCAACACTCAGTGTCCTGATGTG
CAAAATGCATTATTTGTCATGGTTTTACTCACATACATTGTGAGTATGGCGGGAAACTTG
CTCGCTGTGGTGGCTATTATTGCCAGCCCCTCCTTTGGCTCCCCAATGTACTTCTTCCTC
ACTGCCCGTTATTTATGGATGTGGCATATTCCAATACCATTTCTTCCAAATTGATTATAG
ACTTACTCCATGACAAAAAGACTATTTTCTTCACAGCATGCATGGGGCAGCTATTTATAG
ACCACTTATTTGGTGGTGCTGAGGTCTTCCTACTTGTGGGGATGTCCTACGATTGCTATG
TGGCCATCTCTAAGCCACTGCACTATTTGACCATCATGAATCAACAGGTTTGTATCCTTC
TGTTGGTGGTGGCTGTGTCTGCAGGTTTTGTGAGCTGTGTGTTTCAAATTGTTGTTGTGT
ACACTCTCTCATTCTGTGGCCCAATGTCACTGACCACTTTGTCTGTGACATGTACCCATT
ACTGGAACTGGCGTGCACTGATACCTACTTTATAGGCCTCACTGTTGTTGCCAATGGTCT
AGCAATCTGTATGGTCATCTTCACCTTTCTACTAATCTCCTATGGAGTAATCCTAAACAC
CCTTAAAACTTATTGCCAGGAAGGGAGGTGTAAAGCCCTTTCTGCCTGCATCTCCTACAT
TACAGTCACTGTCCTGTTTCTTGTTCCCTGTGTTTTCCTTTTTGTTAGACCTGTTTCAAA
CGTTCCTATTGATAAATTCATGACTGTGTTTTATACAGTTATCACACACCCATGTTGAAT
CCTTTAATATACACACTGAGAAATTTAGAGATGAGAATTGCTGTAAAAGCCAATGTAAAA
AAACCCTGGCATAAAAACTTA
Conceptual translation LQVLFSXLNCDRSLREEXGLSNNITEFVLLGNTQCPDVQNALFVMVLLTYIVSMAGNL
LAVVAIIASPSFGSPMYFFL/CPLFMDVAYSNTISSKLIIDLLHDKKTIFFTACMGQLF
IDHLFGGAEVFLLVGMSYDCYVAISKPLHYLTIMNQQVCILLLVVAVSAGFVSCVFQIVV
VYTLSFC/PNVTDHFVCDMYPLLELACTDTYFIGLTVVANGLAICMVIFTFLLISYGVI
LNTLKTYCQEGRCKALSACISYITVTVLFLVPCVFLFVRPVSNVPIDKFMTVFYTVIT/
PMLNPLIYTLRNLEMRIAVKANVKKPWHKNL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI)
11 48,627,764 48,627,764 SNP T/C 1000GP (CEU, CHBJPT)
11 48,649,141 48,649,141 SNP A/G rs11820609 (DbSNP)
11 48,649,316 48,649,316 SNP C/T rs10742862 (DbSNP)
11 48,649,409 48,649,409 SNP G/T rs10838988 (DbSNP)
11 48,649,762 48,649,762 SNP C/T rs11039886 (DbSNP)
11 48,649,801 48,649,801 SNP A/T rs11039887 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,479,497 48,689,328 CopyNumber Variation_5013 (DGV)
11 48,648,932 48,652,012 Deletion #212 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.