Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A46P Olfactory Receptor

Gene Symbol OR4A46P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.8.15P
External Ids HGNC: 31265   
Build #39 labels
Chromosomal location 11:48,496,318-48,497,258 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A2P 93.42% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A2 88% 304
Chimp CONTIG3007.4-8543 96% 313
Chimp CONTIG2087.7-711 92% 304
Mouse Or4a2 88% 304
Rat Or4a2 88% 304
Cow OR4A2 89% 304
Cow OR4A2C 81% 304

Sequence information

Nucleotide sequence CTGGAATAAGGACATACAGAAAGACGTACGGAGCAAAGGAACAATGTGACTGAGTTTGTC
CTTGTGGGGCTCACTCAGAGCCCCCAGGGACAGAAAATATTATTTGTTGTGTTCTTGCTC
ATCTACATTGTGACAATGGTAGGCAACATATTCATTGTTGTGACTGTGGTGGTCAGCCCA
ACTTTGGATGCCCCATGTACTTCTTCCTTGTCTACTTATCATTTATGGATGCTGTTCATT
CTACTACAGTTACCCCAAATATGATTATATACTTACTCTATGAGAAGAAAACCATTTCGT
TCCAAGCTTGCATGACCCAGCTTTTTATAGGACACCCATTTGGGGGTGCTGAGATTTTAC
TCCTGGTTGTCATGGCCTATGAAGGCTACGTGGCCATCTGCAAACCCCTGCATTATTTGA
CCATCATGAACCAACGGGTGTGCATTCTACTGCTGCTGTTGGCCTGGGCTGGAGGTTTCC
TGCATGCTGTAGTTCAACTTCTTTTTGTTTACAACTTTCCCTTCTGTGGCCCCAATGTCA
TTGAGCATTTCATCTGTGACATGTACCCTTTATTAAAACTTGCCTGCACTGACACCTACG
TTATTGGCCTCACTGTGGTTGCCAATGATGGGGCAATCTGTGTGGTCATCTTTATGCTCT
TACTCATCTCCTATAGGGTCATTCTGCACTCCCTGAAGAATCTTAGTGAGGAAGGGAGGC
CCAAAGCCTTATCCACCTGTGGCTCCCACATCACTGGGGTGATCCTCTTCTTTGTCCCTT
GTATTTTGATGTATGTGAGACCTCCTTCGACCTTACCCATTGATAAATCCTTGACTGTGT
TTTACACTGTTATCACCCCTATGTTGAACCCTCTAATCTATACTTTAAGAAATGCAGAGA
TGAAAAATGCTATGAAGAAGCTCTGGACCAGAAAAAGAAAA
Conceptual translation LEXHTERRTEQRNNVTEFVLVGLTQSPQGQKILFVVFLLIYIVTMVGNIFIVVTVVVSP
T/GCPMYFFLVYLSFMDAVHSTTVTPNMIIYLLYEKKTISFQACMTQLFIGHPFGGAEI
LLLVVMAYEGYVAICKPLHYLTIMNQRVCILLLLLAWAGGFLHAVVQLLFVYNFPFCGPN
VIEHFICDMYPLLKLACTDTYVIGLTVVANDGAICVVIFMLLLISYRVILHSLKNLSEEG
RPKALSTCGSHITGVILFFVPCILMYVRPPSTLPIDKSLTVFYTVITPMLNPLIYTLRNA
EMKNAMKKLWTRKRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI)
11 48,496,343 48,496,343 SNP G/A 1000GP (CEU, CHBJPT)
11 48,517,877 48,517,876 Ins(1) -/T rs35477351 (DbSNP)
11 48,517,878 48,517,877 Ins(1) -/T rs66718415 (DbSNP)
11 48,517,895 48,517,895 SNP A/G rs11039779 (DbSNP)
11 48,518,126 48,518,125 Ins(1) -/C rs35074257 (DbSNP)
11 48,518,159 48,518,159 SNP A/T rs73466718 (DbSNP)
11 48,518,349 48,518,349 SNP C/T rs7395360 (DbSNP)
11 48,518,677 48,518,677 SNP C/T rs7395646 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 232 (Hasin)
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,479,497 48,689,328 CopyNumber Variation_5013 (DGV)
11 48,517,770 48,520,810 Deletion #207 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.