Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A47 Olfactory Receptor

Gene Symbol OR4A471 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.18 (functional)
Aliases OR11-113, HsOR11.8.13
External Ids HGNC: 31266   GeneBank: BK004380, NM_001005512   
Build #39 labels
Chromosomal location 11:48,488,793-48,489,719 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A19P 90.61% 309
OR4A4P 93.85% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A47 85% 308
Dog OR4A47F 85% 308
Dog OR4A47C 84% 308
Dog OR4A47D 82% 308
Dog OR4A47B 83% 300
Dog OR4A47E 84% 308
Dog OR4A47GP 82% 308
Chimp CONTIG2087.6-861 95% 309
Mouse Or4a47 81% 306
Rat Or4a47 81% 307
Cow OR4A104 78% 308
Cow OR4A47P 82% 300

Expression evidences

Source Accession
mRNA BC140738

Sequence information

Nucleotide sequence ATGGAGCCAAGGAAAAATGTGACTGACTTTGTCCTCTTGGGCTTCACACAGAATCCAAAG
GAGCAGAAAGTACTTTTTGTTATGTTCTTGCTCTTCTACATTTTGACCATGGTGGGCAAC
CTGCTCATTGTAGTGACCGTAACTGTCAGTGAGACCCTGGGCTCACCAATGTACTTCTTT
CTTGCTGGCTTATCATTTATAGATATCATTTATTCTTCATCCATTTCCCCCAGATTGATT
TCAGGCTTGTTCTTTGGGAATAATTCCATATCCTTCCAATCTTGCATGGCCCAGCTCTTT
ATCGAGCACATTTTCGGTGGGTCAGAGGTCTTTCTCCTGTTGGTGATGGCCTATGACTGC
TATGTGGCCATCTGTAAGCCCTTGCATTATTTGGTTATCATGAGACAATGGGTGTGTGTT
GTGCTGCTGGTAGTGTCCTGGGTTGGAGGATTTCTGCACTCAGTATTTCAACTTAGCATT
ATTTATGGGCTCCCATTCTGTGGCCCCAATGTCATTGATCATTTTTTCTGTGACATGTAT
CCCTTATTGAAACTGGTCTGCACTGACACCCATGCTATTGGCCTCTTAGTGGTGGCCAAT
GGAGGACTGGCTTGCACTATTGTGTTTCTGCTCTTACTCATCTCTTATGGTGTCATCTTG
CACTCTTTAAAGAACCTTAGTCAGAAAGGGAGGCAAAAAGCCCTCTCAACCTGCAGTTCC
CACATGACTGTGGTTGTCTTCTTCTTTGTTCCTTGTATTTTTATGTATGCTAGACCTGCT
AGGACCTTCCCCATTGACAAATCAGTGAGTGTGTTTTATACAGTCATAACCCCAATGCTG
AACCCCTTAATCTACACTCTGAGAAATTCTGAGATGACAAGTGCTATGAAGAAGCTCTGG
AGAAGAGACCTCATATCAAGTAGTACA
Conceptual translation MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF
LAGLSFIDIIYSSSISPRLISGLFFGNNSISFQSCMAQLFIEHIFGGSEVFLLLVMAYDC
YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVFQLSIIYGLPFCGPNVIDHFFCDMY
PLLKLVCTDTHAIGLLVVANGGLACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSS
HMTVVVFFFVPCIFMYARPARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLW
RRDLISSST

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/C I/L 1000GP (YRI, YRI, YRI)
11 100 -100 SYN T/C Y/Y 1000GP (YRI, YRI)
11 48,489,146 48,489,146 SYN T/C Y/Y 1000GP (CHBJPT)
11 48,489,498 48,489,498 NS T/C S/P 1000GP (CEU)
11 48,510,517 48,510,517 NS A/C Y/S rs12805127 (DbSNP)
11 48,510,537 48,510,537 NS A/T T/S rs12806692 (DbSNP)
11 48,510,589 48,510,589 NS A/G D/G rs12805819 (DbSNP)
11 48,510,628 48,510,628 NS G/T C/F rs12805853 (DbSNP)
11 48,510,654 48,510,654 NS A/C I/L rs7103557 (DbSNP)
11 48,510,777 48,510,777 NS A/G M/V rs7103992 (DbSNP)
11 48,510,919 48,510,919 NS A/C D/A rs7103932 (DbSNP)
11 48,511,037 48,511,037 SYN A/G R/R rs7479221 (DbSNP)
11 48,511,054 48,511,054 NS A/C N/T rs73464794 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,479,497 48,689,328 CopyNumber Variation_5013 (DGV)
11 48,510,245 48,513,271 Deletion, CopyNumber #281 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G54D Y58S G82D C95F I104L V141L V145M A192D A234V S236P % Freq CORP
1 G Y G C L V M A A S 49.46 0.400
2 G Y G C I V V A A S 45.39 0.400
3 G Y G C L V M D A S 1.15 0.400
4 G Y G C L V M A A P 0.84 0.512
5 D Y G C L V M A A S 0.61 0.400
6 G Y G C I V M A A S 0.46 0.400
7 G Y G C I V V A V S 0.38 0.656
8 G Y D C I L V A A S 0.23 0.400
9 G Y D C L L V A A S 0.23 0.400
10 G Y G C L V V A A S 0.15 0.400
11 G Y G C L L M A A S 0.15 0.400
12 G Y G C I L V A A S 0.08 0.400
13 G S D F L V M A A S 0.08 0.999
14 G S G C L L V A A S 0.08 0.910
15 G S D C I L V A A S 0.08 0.910
16 G S G C L L M A A S 0.08 0.910
17 G Y D C I V V A A S 0.08 0.400
18 G S D F L L V A A S 0.08 0.999
19 G S G C L V M A A S 0.08 0.910
20 G Y D F L V M A A S 0.08 0.982
21 G S D F L L M A A S 0.08 0.999
22 G Y G C L L V A A S 0.08 0.400
23 G Y G F L L V A A S 0.08 0.982

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4A47.aApr07-unspliced main_exon CDS chr11 48,488,793 48,489,719 +
3UTR chr11 48,489,719 48,489,722 +