Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A49P Olfactory Receptor

Gene Symbol OR4A49P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases
External Ids HGNC: 31268   GeneBank: NG_004419   
Build #39 labels
Chromosomal location 11:49,915,112-49,915,543 (-)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A2P 63.64% 99
OR4A46P 85.07% 67

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A2 64% 100
Chimp CONTIG3007.4-8543 63% 99
Chimp CONTIG2087.7-711 62% 97
Mouse Or4a2 62% 100
Rat Or4a2 62% 100
Cow OR4AJ1P 58% 100

Sequence information

Nucleotide sequence ATGACAGAGTTTGTCCTTGTGGGGCTCACTCAGAGCCCCCAGGGACAGAAAATATTATTT
GTTGTGTTCTTGCTCATCTACCTTGTGACAATGGTAGGTGACATACTCATTGTTGTAACT
GTGGTGGTCAGCCCAACTTTGGATGCCCCTATGTACTTCTTCCTTGGGTACTTATCATTA
ATGGATGCTGTTTAGTCCTCAGGTGAAGCAGCTTGTTTTGGTTCCATATTTATATAAAAA
TGATCCATTGATCTTCCCAGATGTTTAGAATATCTGATAATACCTCTGCTATTTTCAATA
CCCCCTTCTCATGGCCTTCTAAAAAACAGCCAGGCTCTGCTTTTTATATGTAAAATCAGC
ATAATCCATAATCTATGAACTTCAAATATGCAATGCAGAGCCTGATAGCAAATATTTTGG
AATACACCACTG
Conceptual translation MTEFVLVGLTQSPQGQKILFVVFLLIYLVTMVGDILIVVTVVVSPTLDAPMYFFLGYLSL
MDAVXSG-EAACFGSIFIXXIDLPRCLEYLIIPLLFSIPPSHGLLKNSQALLFICKI
SIIHNLXSNMQCRAXQIFW

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI)
11 49,915,114 49,915,114 SNP A/G 1000GP (CEU, CHBJPT)
11 49,915,501 49,915,501 SNP T/C 1000GP (CEU)
11 49,936,666 49,936,666 SNP G/A rs4474434 (DbSNP)
11 49,936,687 49,936,687 SNP G/A rs4991008 (DbSNP)
11 49,936,716 49,936,716 SNP C/G rs4991009 (DbSNP)
11 49,936,739 49,936,739 SNP G/A rs4991010 (DbSNP)
11 49,936,751 49,936,751 SNP G/A rs4991011 (DbSNP)
11 49,937,053 49,937,053 SNP C/T rs4881657 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)
11 49,934,664 49,937,195 Deletion #213 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.