Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A5 Olfactory Receptor

Gene Symbol OR4A51 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR11-111, HsOR11.10.2, ORL3308
External Ids HGNC: 15162   GeneBank: BK004378   ORDB: ORL3308   
Build #39 labels OR4A5
Chromosomal location 11:54,706,884-54,707,828 (-)
Cluster 11@51
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A42P 91.5% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 76% 302
Mouse Or4a39 75% 305
Rat Or4a77e 73% 306
Cow OR4A2 69% 303
Orang OR4A47P 65% 304
Horse OR4A148P 75% 305
Chimp OR4A5P 95% 308

Expression evidences

Source Accession
mRNA BC140750
GNF Atlas2 gnf1h05420_at

Sequence information

Nucleotide sequence ATGAGACAGAATAACAATATTACAGAATTTGTCCTCCTGGGCTTTTCTCAGGATCCTGGT
GTGCAAAAAGCATTATTTGTCATGTTTTTACTCACATACTTGGTGACAGTGGTGGGGAAC
CTGCTCATTGTGGTGGATATTATTGCCAGCCCTTCCTTGGGTTCCCCAATGTATTTCTTC
CTTGCCTGCCTGTCATTTATAGATGCTGCATATTCCACTACCATTTCTCCCAAGTTAATT
GTAGGCTTATTCTGTGATAAAAAGACTATTTCCTTCCAAGGTTGCATGGGCCAGCTATTT
ATAGACCATTTCTTTGGTGGGGCTGAGGTCTTCCTTCTGGTGGTGATGGCCTGTGATCGC
TATGTGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAATCGACAGGTTTGCTTC
CTTCTGTTGGTGGTGGCCATGATTGGAGGTTTTGTACATTCTGCGTTTCAAATTGTTGTG
TACAGTCTCCCTTTCTGTGGTCCCAATGTCATTGTTCATTTCAGTTGTGACATGCACCCA
TTACTGGAACTGGCATGCACTGACACCTACTTTATAGGCCTCACTGTTGTTGTCAATAGT
GGAGCAATCTGTATGGTCATTTTCAACCTTCTGTTAATCTCCTATGGAGTCATCCTAAGC
TCCCTTAAAACTTACAGTCAGGAAAAGAGGGGTAAAGCCTTGTCTACCTGCAGCTCCGGC
AGTACCGTTGTTGTCCTCTTTTTTGTACCCTGTATTTTCATATATGTTAGACCTGTTTCA
AACTTTCCTACTGATAAGTTCATGACTGTGTTTTATACCATTATCACACACATGCTGAGT
CCTTTAATATATACGTTGAGAAATTCAGAGATGAGAAATGCTATAGAAAAACTCTTGGGT
AAAAAGTTAACTATATTTATTATAGGAGGAGTGTCCGTCCTCATG
Conceptual translation MRQNNNITEFVLLGFSQDPGVQKALFVMFLLTYLVTVVGNLLIVVDIIASPSLGSPMYFF
LACLSFIDAAYSTTISPKLIVGLFCDKKTISFQGCMGQLFIDHFFGGAEVFLLVVMACDR
YVAICKPLHYLTIMNRQVCFLLLVVAMIGGFVHSAFQIVVYSLPFCGPNVIVHFSCDMHP
LLELACTDTYFIGLTVVVNSGAICMVIFNLLLISYGVILSSLKTYSQEKRGKALSTCSSG
STVVVLFFVPCIFIYVRPVSNFPTDKFMTVFYTIITHMLSPLIYTLRNSEMRNAIEKLLG
KKLTIFIIGGVSVLM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/T L/Q 1000GP (YRI)
11 51,411,460 51,411,460 SYN G/A S/S rs34285763 (DbSNP)
11 51,411,530 51,411,530 nonsense SNP G/T S/* rs5029499 (DbSNP)
11 51,411,544 51,411,544 SYN A/G Y/Y rs5011061 (DbSNP)
11 51,411,561 51,411,561 SYN A/G L/L rs5011060 (DbSNP)
11 51,411,584 51,411,584 NS A/G F/S rs5011059 (DbSNP)
11 51,411,662 51,411,662 NS A/G V/A rs5011058 (DbSNP)
11 51,411,667 51,411,667 SYN A/C V/V rs5011057 (DbSNP)
11 51,411,674 51,411,674 NS A/C I/S rs5011056 (DbSNP)
11 51,411,678 51,411,678 NS C/G G/R rs5011055 (DbSNP)
11 51,411,704 51,411,704 NS C/T G/D rs5029500 (DbSNP)
11 51,411,705 51,411,705 NS C/G G/R rs5029501 (DbSNP)
11 51,411,740 51,411,740 NS A/T L/Q rs35083184 (DbSNP)
11 51,411,914 51,411,914 NS C/T C/Y rs61890334 (DbSNP)
11 51,411,940 51,411,940 SYN C/T V/V rs5002410 (DbSNP)
11 51,412,066 51,412,066 SYN A/G V/V rs5002409 (DbSNP)
11 51,412,075 51,412,075 SYN A/C G/G rs5002408 (DbSNP)
11 51,412,077 51,412,077 NS C/T G/R rs5002407 (DbSNP)
11 51,412,078 51,412,078 SYN A/G G/G rs5002406 (DbSNP)
11 51,412,118 51,412,118 NS G/T P/Q rs5002405 (DbSNP)
11 51,412,146 51,412,146 NS A/G F/L rs5002404 (DbSNP)
11 51,412,151 51,412,151 NS C/T G/D rs5002403 (DbSNP)
11 51,412,251 51,412,251 NS C/T A/T rs72482364 (DbSNP)
11 51,412,327 51,412,327 NS A/T N/K rs56302591 (DbSNP)
11 51,412,353 51,412,353 NS A/T F/I rs61890335 (DbSNP)
11 51,412,379 51,412,379 NS C/T S/N rs10902343 (DbSNP)
11 54,707,413 54,707,413 NS T/C D/G 1000GP (CEU)
11 54,707,461 54,707,461 NS C/T G/D 1000GP (CEU)
11 54,707,539 54,707,539 NS A/T L/Q 1000GP (CEU, CHBJPT)
11 54,707,819 54,707,819 SYN G/A S/S 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 51,192,824 51,563,636 CopyNumber Variation_8689 (DGV)
11 51,228,146 51,525,878 CopyNumber Variation_48823 (DGV)
11 51,372,036 51,529,002 CopyNumber Variation_53111 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L219Q Y161C V160M A62V % Freq CORP
1 L Y V A 86.18 0.287
2 Q Y V A 9.29 0.287
3 L C V A 3.53 0.287
4 L Y V V 0.54 0.287
5 L Y M A 0.38 0.287
6 Q C V A 0.08 0.287

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4A5.aApr07-unspliced main_exon CDS chr11 54,706,884 54,707,828 -
3UTR chr11 54,707,828 54,707,831 -