Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A6P Olfactory Receptor

Gene Symbol OR4A6P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-108, HsOR11.10.1P, ORL3584
External Ids HGNC: 15163   GeneBank: BK004781, NG_004329   ORDB: ORL3584   
Build #39 labels OR4A6P
Chromosomal location 11:54,724,847-54,725,816 (-)
Cluster 11@51
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A44P 91.69% 325

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 69% 301
Mouse Or4a39 71% 303
Rat Or4a81 68% 303
Cow OR4A2 64% 307
Orang OR4A47P 61% 301
Horse OR4A124 70% 303
Chimp OR4A44P 92% 305

Sequence information

Nucleotide sequence TTACAGGTCCTGTTCTCCTGAGCTCTCAACTGTGACAGAAGCCTTAGAGAAGAGTAAAGG
GGACTGAGTAATAATGTTACAGAATTTGTCCTCTTGGGCAACACTCAGTGTCCTGATGTG
CAAAATGCATTATTTGTCATGGTTTTACTCACATACGTTGTGAGTATGGCGGGAAACTTG
CTTGCTGTGGTGGCTATTATTTCCAGCCCTTCCTTTGGCTCCCCAATGTACTTCTTCCTC
ACAGCCTGTTATTTATATATGCTGCATATTCCAATACCATTTCTCCCAAATTGATTATAG
GCTTACTCCATGATAAAAAGACTATTTTCTTCACAGCATGCATGGGGCAGCTATTTATAG
ACCACTTATTTGGTGGTGCTGAGGTCTTCCTACTTGTGGGGATGTCCTACGATTTCTATG
TGGCCATCTCTAAGCCACTGCACTATTTGACCATCATGAATCAACAGGTTTGTATCCTTC
TGTTGGTGGTGGCTGTGACTGGAGGTTTTGTGAGTTGTGTGTTTCAAATTGTTGTTGTGT
ACACTCTCTCGTTCTGTGGCCAAATGTCACTGACCACTTTGTCTGTGACATGTACCCATT
ATTGGAACTGGTTTGCACTGATACCTACTTTATAGGTCTCACTGTTGTTGCCAATGGTCT
AGCAATCTGTATGGTCGTCTTCACCCTTCTACTAATCTCCTATGGAGTCATCCTAAACAA
CTTTAAAACTTATAGTCAGGAAGGGAGGCTTAAAGCCCTGTCTGCCTGCATCTCCTACAT
AACAGTCACTGTCCTGTTTCTTGTTCCCTGTATTTTCCTTTTCGTTAGACCTGTTTCGAA
CTTTCCTATTGATAAATTCATGACTGTGTTTTATACAGTTATCATACACATGTTGAATCC
ATTAATATACACACTGAGAAATTTAGAGATGAGAATTGCTGTAAAATCCAATGTAAAAAA
ACTCTGGCAT
Conceptual translation LQVLFSXLNCDRSLREEXGLSNNVTEFVLLGNTQCPDVQNALFVMVLLTYVVSMAGNL
LAVVAIISSPSFGSPMYFFLT/LLFIYAAYSNTISPKLIIGLLHDKKTIFFTACMGQLF
IDHLFGGAEVFLLVGMSYDFYVAISKPLHYLTIMNQQVCILLLVVAVTGGFVSCVFQIVV
VYTLSFC/PNVTDHFVCDMYPLLELVCTDTYFIGLTVVANGLAICMVVFTLLLISYGVI
LNNFKTYSQEGRLKALSACISYITVTVLFLVPCIFLFVRPVSNFPIDKFMTVFYTVIIHM
LNPLIYTLRNLEMRIAVKSNVKKLWH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI)
11 51,393,529 51,393,529 SNP T/G rs1498429 (DbSNP)
11 51,393,718 51,393,718 SNP G/T rs11246539 (DbSNP)
11 51,393,820 51,393,820 SNP C/A rs499232 (DbSNP)
11 51,393,840 51,393,840 SNP A/G rs12422078 (DbSNP)
11 51,394,003 51,394,003 SNP A/G rs12576977 (DbSNP)
11 51,394,148 51,394,148 SNP G/A rs72480356 (DbSNP)
11 51,394,223 51,394,223 SNP A/G rs572049 (DbSNP)
11 51,394,262 51,394,262 SNP C/T rs73465443 (DbSNP)
11 51,394,275 51,394,275 SNP A/G rs572196 (DbSNP)
11 51,394,403 51,394,403 SNP T/G rs549117 (DbSNP)
11 54,725,003 54,725,003 SNP C/T 1000GP (CEU)
11 54,725,004 54,725,004 SNP A/G 1000GP (CEU, CHBJPT)
11 54,725,396 54,725,396 SNP G/A 1000GP (CEU)
11 54,725,459 54,725,459 SNP A/C 1000GP (CEU)
11 54,725,561 54,725,561 SNP T/G 1000GP (CHBJPT)
11 54,725,654 54,725,654 SNP G/A 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 51,192,824 51,563,636 CopyNumber Variation_8689 (DGV)
11 51,228,146 51,525,878 CopyNumber Variation_48823 (DGV)
11 51,372,036 51,529,002 CopyNumber Variation_53111 (DGV)
11 51,391,463 51,394,532 Deletion #214 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.