Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A8P Olfactory Receptor

Gene Symbol OR4A8P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-110, HsOR11.10.4P, ORL3587
External Ids HGNC: 15165   GeneBank: AF546448-AF546461, BK004702, NG_004235   ORDB: ORL3587   
Build #39 labels OR4A8P
Chromosomal location 11:54,682,876-54,683,820 (-)
Cluster 11@51
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP T->C at position 406 (AA change= */R )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A11P 83.67% 300
OR4A40P 87.94% 315
OR4A45P 79.93% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 72% 312
Chimp CONTIG2087.8-12454 94% 315
Mouse Or4a39 72% 308
Rat Or4a74 70% 299
Cow OR4A2 67% 299

Sequence information

Nucleotide sequence ATGAGGCAGAATAACAATATTACAGAATTTGTCCTCCTGGGCTTCTCTCAGTATCCTGAT
GTGCAAAATGCATTATTTGTCATGTTTTTACTCATATATATTGTGACTATGGTGGGGAAC
CTGCTCATTGTGGTGTCTATTATTGCCAGTCCCTTTTTGGGCTCCCCAGTGTACTTCTTC
CTTGCCTGCCTGTCATTTATAGATGCTGTGTATTCCACCACCATTTCTCCTGTATTGATT
GTAGACTTACTCTGTGATAAAAAGACTATTTCCTTCCCAGCTTGCATGGGTCAGCTATTT
ATAGAGCACTTGTTTGGTGATACTGACGTCTTCCTTCTGGTGGTGATGGCCTATGATCGC
TACGTGGCCACCTGTAAGCCACTGCGCTATTTGACCATCATGAATTGACAGGTTTGCATC
CTTCTGTTGGTGGTGGCTGTGACTGGAGGTTTTCTGCATTCTGTGTTTCAAATTTTAGTT
GTGTACAGTCTCCCTTTCTGTGGCCCCAATGTCATTTATCACTTTTTCTGTAACATATAC
CCTTTATTGGACCTGGAATGCACTGACACCTACTTCGTAGGCCTCGCTGTGGTTTTCAAT
GGTGGAGCAATCTGTATGGTCATCTTCACCCTTCTACTAATCTCCTATGGGGTCATCCTA
AACTCCCTTAAAACTTATAGTCCGGAAGGGAGGCATAAAGCTCCGTTTATCTGCAGCTCC
CACTTTATCATGGTTATCTTGTTTTTTGTTCCCTGTATTTTCTTATATGTTAGACCCGTT
TCAAACTTTCCTATTGATAAATTCCTGACTGTGTTTTATTCAGTTATCACACCCAAGTTG
AATCCTTTTATATACATGTTGAGAAATTCAGAGATGAGAAATGCTATAGAAAATCTCTTG
GGATACCAAAGTGGGAAGACAGGATTTAGATGCTCCAAGCTCAAT
Conceptual translation MRQNNNITEFVLLGFSQYPDVQNALFVMFLLIYIVTMVGNLLIVVSIIASPFLGSPVYFF
LACLSFIDAVYSTTISPVLIVDLLCDKKTISFPACMGQLFIEHLFGDTDVFLLVVMAYDR
YVATCKPLRYLTIMNXVCILLLVVAVTGGFLHSVFQILVVYSLPFCGPNVIYHFFCNIY
PLLDLECTDTYFVGLAVVFNGGAICMVIFTLLLISYGVILNSLKTYSPEGRHKAPFICSS
HFIMVILFFVPCIFLYVRPVSNFPIDKFLTVFYSVITPKLNPFIYMLRNSEMRNAIENLL
GYQSGKTGFRCSKLN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/T 1000GP (YRI, YRI, YRI)
11 51,435,510 51,435,510 SNP A/T rs485548 (DbSNP)
11 51,435,848 51,435,847 Ins(1) -/A rs34678533 (DbSNP)
11 51,435,852 51,435,852 SNP G/T rs539871 (DbSNP)
11 51,435,866 51,435,866 SNP A/G rs61891402 (DbSNP)
11 51,436,215 51,436,215 SNP A/G rs1846261 (DbSNP)
11 54,682,916 54,682,916 SNP C/A 1000GP (CEU)
11 54,683,413 54,683,413 SNP A/G 1000GP (CEU)
11 54,683,427 54,683,427 SNP G/T 1000GP (CEU)
11 54,683,464 54,683,464 SNP C/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 51,192,824 51,563,636 CopyNumber Variation_8689 (DGV)
11 51,228,146 51,525,878 CopyNumber Variation_48823 (DGV)
11 51,372,036 51,529,002 CopyNumber Variation_53111 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.