Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4B1 Olfactory Receptor

Gene Symbol OR4B11 (View this gene in GeneCards)
Family 4
Subfamily B
Pseudogene No
CORP pseudogene probability score
Aliases OST208, OR11-106, HsOR11.8.1, ORL3379
External Ids HGNC: 8290   GeneBank: AB065848, AF399579, BK004387, NM_001005470   ORDB: ORL3379   
Build #39 labels OR4B1
Chromosomal location 11:48,216,810-48,217,736 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4B2P 71.2% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4B1E 85% 308
Mouse Or4b1 83% 303
Mouse Or4b1b 80% 309
Mouse Or4b1c 82% 299
Mouse Or4b1d 81% 304
Rat Or4b1c 83% 305
Rat Or4b1 83% 304
Rat Or4b1b-ps 82% 305
Cow OR4B1H 84% 309
Orang OR4B2P 70% 309
Horse OR4B1I 82% 309
Chimp OR4B2P 71% 309

Expression evidences

Source Accession
GNF Atlas2 gnf1h10913_at

Sequence information

Nucleotide sequence ATGGCCAGTACAAGTAATGTGACTGAGTTGATTTTCACTGGCCTTTTCCAGGATCCAGCT
GTGCAGAGTGTATGCTTTGTGGTGTTTCTCCCCGTGTACCTTGCCACGGTGGTGGGCAAT
GGCCTCATCGTTCTGACGGTCAGTATCAGCAAGAGTCTGGATTCTCCCATGTACTTCTTC
CTTAGCTGCCTGTCCTTGGTGGAGATCAGTTATTCCTCCACTATCGCCCCTAAATTCATC
ATAGACTTACTTGCCAAGATTAAAACCATCTCTCTGGAAGGCTGTCTGACTCAGATATTC
TTCTTCCACTTCTTTGGGGTTGCTGAGATCCTTTTGATTGTGGTGATGGCCTATGATTGC
TACGTGGCCATTTGCAAGCCTCTTCATTATATGAACATTATCAGTCGTCAACTGTGTCAC
CTTCTGGTGGCTGGTTCCTGGCTGGGGGGCTTTTGTCACTCCATAATTCAGATTCTCGTT
ATCATCCAATTGCCCTTCTGTGGTCCCAATGTGATTGACCACTATTTCTGTGACCTCCAG
CCTTTATTCAAGCTTGCCTGCACTGACACCTTCATGGAGGGGGTTATTGTGTTGGCCAAC
AGTGGATTATTCTCTGTCTTCTCCTTCCTCATCTTGGTGTCCTCTTATATTGTCATTCTG
GTCAACTTGAGGAACCATTCTGCAGAGGGGAGGCACAAAGCCCTCTCCACCTGTGCTTCT
CACATCACAGTGGTCATCTTGTTTTTTGGACCTGCTATCTTCCTCTACATGCGACCTTCT
TCCACTTTCACTGAAGATAAACTTGTGGCTGTATTCTACACGGTCATCACCCCCATGCTG
AACCCCATCATTTACACACTCAGGAATGCAGAGGTGAAAATCGCCATAAGAAGATTGTGG
AGCAAAAAGGAGAATCCAGGGAGGGAG
Conceptual translation MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFF
LSCLSLVEISYSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDC
YVAICKPLHYMNIISRQLCHLLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQ
PLFKLACTDTFMEGVIVLANSGLFSVFSFLILVSSYIVILVNLRNHSAEGRHKALSTCAS
HITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKIAIRRLW
SKKENPGRE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A V/I 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/G A/A 1000GP (YRI, YRI)
11 48,216,869 48,216,869 SYN T/G A/A 1000GP (CEU)
11 48,216,870 48,216,870 NS G/A V/M 1000GP (CHBJPT)
11 48,216,997 48,216,997 NS G/A C/Y 1000GP (CEU, CHBJPT)
11 48,217,328 48,217,328 SYN C/T D/D 1000GP (CEU, CHBJPT)
11 48,217,519 48,217,519 NS C/A T/N 1000GP (CEU, CHBJPT)
11 48,217,630 48,217,630 NS C/A T/K 1000GP (CEU, CHBJPT)
11 48,238,421 48,238,421 SYN G/T A/A rs10769329 (DbSNP)
11 48,238,496 48,238,496 SYN C/G L/L rs61731420 (DbSNP)
11 48,238,500 48,238,500 NS A/G I/V rs61731419 (DbSNP)
11 48,238,549 48,238,549 NS A/G Y/C rs11606506 (DbSNP)
11 48,238,724 48,238,724 SYN C/T Y/Y rs61731418 (DbSNP)
11 48,238,773 48,238,773 SYN C/T L/L rs61731416 (DbSNP)
11 48,238,880 48,238,880 SYN C/T D/D rs10838833 (DbSNP)
11 48,238,998 48,238,998 NS A/G M/V rs61731415 (DbSNP)
11 48,239,016 48,239,016 NS A/G I/V rs61731414 (DbSNP)
11 48,239,071 48,239,071 NS A/C N/T rs12292056 (DbSNP)
11 48,239,182 48,239,182 NS A/C/T K/T rs7130086 (DbSNP)
11 48,239,215 48,239,215 NS A/G Y/C rs61731410 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 48,238,262 48,241,288 CopyNumber #138 (Waszak)
11 48,238,610 48,238,837 Del(-17) #19(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V47I C63Y V213M I219V T237N T274K % Freq CORP
1 V C V I T T 65.90 0.719
2 V Y V I T K 19.97 0.719
3 V C V I N T 11.06 0.905
4 V Y V I T T 1.23 0.719
5 I C V V T T 1.15 0.719
6 V C M I N T 0.46 0.905
7 V C V I T K 0.23 0.719

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4B1.aApr07-unspliced main_exon CDS chr11 48,216,810 48,217,736 +
3UTR chr11 48,217,736 48,217,739 +