Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4B2P Olfactory Receptor

Gene Symbol OR4B2P1 (View this gene in GeneCards)
Family 4
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases hg449, HsOR11.8.2P, ORL3523
External Ids HGNC: 8291   GeneBank: AF399445, NG_004136   ORDB: ORL3523   
Build #39 labels OR4B2P
Chromosomal location 11:48,227,429-48,228,331 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4B1 71.2% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4B1 72% 309
Mouse Or4b1 67% 304
Rat Or4b1 66% 309
Cow OR4B1G 71% 309
Orang OR4X2P 53% 299
Horse OR4B1 70% 309
Chimp OR4B1 71% 309

Sequence information

Nucleotide sequence ATGGCCAGTACAAATAATGTGACTGAGTCAATGATCACCAGCCTTTTCCAGGATCCAGCA
GTGCAGAGAGTGTGCTTTGTGGTGTTTCTCCCCGTGTACTGGCCATGGAGGTGGGCAATG
GCCTCATCGTTCTGACGGTCAGTATCAGCAAGAGTCTGCATTCCCCTGTGTACTTCTTCC
TGAGCTACCTGTCATTGATGGAGATCAGTTACTTCACTGTTGTCCCTAAATTCATCACAG
ACTTACTTGCCAAGATTAAAGCCATCTCTCTGGAGGGCTATCTGGCTCAGATATTCTTGC
ACTTCTTTGGCATCCCCTGGATCTTTCTGCTCCCACTGATGACCAATGACCAATATATGG
CCAACTGCAAACTTTATTACTACACAACCATCATGAGCTGCCTGTCTGTCACCTTCTGGT
GGCTGGTTTCTGGCTGAGGGGCATAATTCACTCAATGGTTCAGATCCTTGTCTCTGTCCA
ATTGTTCTTCTGTGGTCCCAACATGATTGACCACTCATTCTGTGACCTCCAGGTCTTATT
CAAGCTTGCCTGCACTGACACCTTTGTGGAGGGGGTTATTGTGTTGGCCAACAGTGAATT
AGTATCTGTCTTCTTCCTTATCTTGGTGTCCTCTTAATATCATCATCCTAGTCAACTTGA
GGAACCATTCTGCAGAGGGGAGGTGCAAAGCCCTCTCCACCTGTGCCTCTTATCTTGTAT
TTTGAACTTGCCATTTTCCTCTACGTGTGACTCTCCTCCACCTTTACTAAAGATAAACTC
GTGGCTGTATTTTACGTGGTCATCACCCCCATGCTGAACCCCTTCATCTACACGCTTGGG
AATGCAGAGATGAAAATCACCATGAGGAGATTGTTGGGCAGGACAGTGAACTCAGGAATG
GAA
Conceptual translation MASTNNVTESMITSLFQDPAVQRVCFVVFLPVY/AMEVGNGLIVLTVSISKSLHSPVYF
FLSYLSLMEISYFTVVPKFITDLLAKIKAISLEGYLAQIFLHFFGIPWIFLLPLMTNDQY
MANCKLYYYTTIMSC/VCHLLVAGFWLRGIIHSMVQILVSVQLFFCGPNMIDHSFCDLQ
VLFKLACTDTFVEGVIVLANSELVSVFFLILVSS\IIILVNLRNHSAEGRCKALSTCAS
YLVFXC\FLYVXSSTFTKDKLVAVFYVVITPMLNPFIYTLGNAEMKITMRRLLGRTV
NSGME

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI)
11 48,227,893 48,227,893 SNP T/A 1000GP (CEU)
11 48,228,227 48,228,227 SNP G/A 1000GP (CEU, CHBJPT)
11 48,228,261 48,228,261 SNP C/T 1000GP (CEU)
11 48,249,779 48,249,779 SNP A/G rs10769331 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 48,248,881 48,251,883 Deletion, CopyNumber #252 (Waszak)
11 48,249,024 48,250,324 CopyNumber Variation_65937 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.