Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C11 Olfactory Receptor

Gene Symbol OR4C111 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR11-136, HsOR11.11.17
External Ids HGNC: 15167   GeneBank: AB065774, BK004503, NM_001004700   
Build #39 labels OR4C11P
Chromosomal location 11:55,603,444-55,604,373 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C16 67.31% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C11E 92% 309
Dog OR4C11I 91% 309
Mouse Or4c11 89% 307
Rat Or4c11 90% 307
Cow OR4C156P 76% 309
Orang OR4C9P 56% 309
Horse OR4C11E 83% 309
Chimp OR4C31 75% 304

Expression evidences

Source Accession
mRNA BC140727
GNF Atlas2 gnf1h10928_at

Sequence information

Nucleotide sequence ATGCAGCAAAATAACAGTGTGCCTGAATTCATACTGTTAGGATTAACACAGGATCCCTTG
AGGCAGAAAATAGTGTTTGTAATCTTCTTAATTTTCTATATGGGAACTGTGGTGGGGAAT
ATGCTCATTATTGTGACCATCAAGTCCAGCCGGACACTAGGAAGCCCCATGTACTTCTTT
CTATTTTATTTGTCCTTTGCAGATTCTTGCTTTTCAACTTCCACAGCCCCTAGATTAATT
GTGGATGCTCTCTCTGAAAAGAAAATTATAACCTACAATGAGTGCATGACACAAGTCTTT
GCACTACATTTATTTGGCTGCATGGAGATCTTTGTCCTCATTCTCATGGCTGTTGATCGC
TATGTGGCCATCTGTAAGCCCTTGCGTTACCCAACCATCATGAGCCAGCAGGTCTGCATC
ATCCTGATTGTTCTTGCCTGGATAGGGTCTTTAATACACTCTACAGCTCAGATTATCCTG
GCCTTAAGATTGCCTTTCTGTGGACCCTATTTGATTGATCATTATTGCTGTGATTTGCAG
CCCTTGTTGAAACTTGCCTGCATGGACACTTACATGATCAACCTGCTGTTGGTGTCTAAC
AGTGGGGCAATTTGCTCAAGTAGTTTCATGATTTTGATAATTTCATATATTGTCATCTTG
CATTCACTGAGAAACCACAGTGCCAAAGGGAAGAAAAAGGCTCTCTCCGCTTGCACGTCT
CACATAATTGTAGTCATCTTATTCTTTGGCCCATGTATATTCATATATACACGCCCCCCG
ACCACTTTCCCCATGGACAAGATGGTGGCAGTATTTTATACTATTGGAACACCCTTTCTC
AATCCACTCATCTACACACTGAGGAATGCAGAAGTGAAAAATGCCATGAGAAAGTTATGG
CATGGCAAAATTATTTCAGAAAACAAAGGA
Conceptual translation MQQNNSVPEFILLGLTQDPLRQKIVFVIFLIFYMGTVVGNMLIIVTIKSSRTLGSPMYFF
LFYLSFADSCFSTSTAPRLIVDALSEKKIITYNECMTQVFALHLFGCMEIFVLILMAVDR
YVAICKPLRYPTIMSQQVCIILIVLAWIGSLIHSTAQIILALRLPFCGPYLIDHYCCDLQ
PLLKLACMDTYMINLLLVSNSGAICSSSFMILIISYIVILHSLRNHSAKGKKKALSACTS
HIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLW
HGKIISENKG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T A/T 1000GP (YRI, YRI, YRI)
11 55,371,021 55,371,021 NS G/T P/T rs2456022 (DbSNP)
11 55,371,039 55,371,039 NS T/C I/V rs61747888 (DbSNP)
11 55,371,132 55,371,132 NS A/T S/T rs7114415 (DbSNP)
11 55,371,275 55,371,275 NS G/A T/M rs61743011 (DbSNP)
11 55,371,285 55,371,284 Ins(1) -/C rs34651794 (DbSNP)
11 55,371,313 55,371,313 NS C/A L/F rs61735721 (DbSNP)
11 55,371,410 55,371,410 NS C/G W/S rs61732335 (DbSNP)
11 55,371,673 55,371,673 NS C/G L/F rs61730928 (DbSNP)
11 55,371,699 55,371,699 NS G/A R/W rs61730871 (DbSNP)
11 55,371,747 55,371,747 NS T/C R/G rs61737219 (DbSNP)
11 55,371,807 55,371,807 NS A/T L/I rs11230346 (DbSNP)
11 55,371,828 55,371,828 NS G/T P/T rs491160 (DbSNP)
11 55,603,656 55,603,656 NS A/T S/T 1000GP (CEU)
11 55,603,905 55,603,905 nonsense SNP G/A Q/* 1000GP (CEU)
11 55,604,331 55,604,331 NS A/T L/I 1000GP (CEU, CHBJPT)
11 55,604,352 55,604,352 NS G/T P/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
Deletion 252 (Hasin)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,335,878 55,453,486 CopyNumber Variation_48051 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,339,829 55,447,427 CopyNumber Variation_53140 (DGV)
11 55,358,496 55,434,466 CopyNumber Variation_37484 (DGV)
11 55,359,025 55,470,359 CopyNumber Variation_0419 (DGV), Variation_34977 (DGV)
11 55,360,213 55,442,368 CopyNumber Variation_48826 (DGV)
11 55,360,213 55,447,426 CopyNumber Variation_29606 (DGV)
11 55,360,213 55,447,427 CopyNumber Variation_9663 (DGV), Variation_48827 (DGV)
11 55,360,213 55,460,788 CopyNumber Variation_53994 (DGV)
11 55,360,213 55,470,003 CopyNumber Variation_48828 (DGV)
11 55,360,213 55,470,994 CopyNumber Variation_54018 (DGV)
11 55,360,213 55,490,377 CopyNumber Variation_53507 (DGV)
11 55,362,651 55,460,561 CopyNumber Variation_34978 (DGV)
11 55,364,237 55,431,910 Inversion Variation_29474 (DGV)
11 55,364,677 55,453,061 CopyNumber Variation_65955 (DGV)
11 55,365,425 55,431,552 CopyNumber Variation_41253 (DGV)
11 55,365,707 55,452,023 CopyNumber Variation_85779 (DGV)
11 55,366,131 55,452,023 CopyNumber Variation_75644 (DGV)
11 55,367,167 55,452,993 CopyNumber Variation_6923 (DGV)
11 55,367,884 55,459,183 CopyNumber Variation_31823 (DGV)
11 55,368,154 55,450,788 CopyNumber Variation_38972 (DGV)
11 55,368,920 55,371,949 Deletion #14 (Waszak)
11 55,371,020 55,460,788 CopyNumber Variation_29910 (DGV)
11 55,371,021 55,408,700 CopyNumber Variation_48829 (DGV)
11 55,371,021 55,418,182 CopyNumber Variation_10361 (DGV), Variation_48830 (DGV), Variation_53101 (DGV)
11 55,371,021 55,422,586 CopyNumber Variation_9662 (DGV), Variation_48831 (DGV)
11 55,371,021 55,437,126 CopyNumber Variation_48832 (DGV)
11 55,371,021 55,442,368 CopyNumber Variation_48833 (DGV)
11 55,371,021 55,447,427 CopyNumber Variation_10359 (DGV), Variation_48834 (DGV), Variation_48835 (DGV)
11 55,371,021 55,460,095 CopyNumber Variation_48836 (DGV)
11 55,371,807 55,373,703 CopyNumber Variation_1890 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V271I S240T A237T M192T Q157* W147S L15I P8T % Freq CORP
1 V S A M Q W L P 58.45 0.274
2 V S A M Q W I P 27.11 0.274
3 V S A M * W L P 5.45 1.200
4 V T A M Q W L T 3.30 0.059
5 V S A M Q S L P 2.53 0.274
6 V S A M Q W L T 2.23 0.274
7 V S A T Q W L T 0.46 0.274
8 I S A M Q W I P 0.31 0.274
9 V S T M Q W L P 0.15 0.093

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C11.aApr07-unspliced main_exon 3UTR chr11 55,603,441 55,603,444 -
CDS chr11 55,603,444 55,604,373 -