Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C12 Olfactory Receptor

Gene Symbol OR4C121 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.18 (functional)
Aliases OR11-259, HsOR11.9.5, ORL3335
External Ids HGNC: 15168   GeneBank: AF399576, BK004413, NM_001005270   ORDB: ORL3335   
Build #39 labels OR4C12
Chromosomal location 11:49,981,575-49,982,501 (-)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C2P 88.35% 309
OR4C50P 86.08% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C12 86% 309
Dog OR4C12C 84% 309
Chimp CONTIG2000.4-9035 98% 309
Mouse Or4c12 84% 309
Mouse Or4c12b 83% 304
Rat Or4c12 84% 303
Rat Or4c12b-ps 83% 302
Cow OR4C12 82% 309
Cow OR4C12DP 83% 276

Expression evidences

Source Accession
mRNA BC136851
GNF Atlas2 gnf1h02093_s_at

Sequence information

Nucleotide sequence ATGGAGAAGAAAAAGAATGTGACTGAATTCATTTTAATAGGTCTTACACAGAACCCCATA
ATGGAGAAAGTCACGTTTGTAGTATTTTTGGTTCTTTACATGATAACACTTTCAGGCAAC
CTGCTCATTGTGGTTACCATTACCACCAGCCAGGCTCTGAGCTCCCCCATGTACTTCTTC
CTGACCCACCTTTCTTTGATAGACACAGTTTATTCTTCTTCTTCAGCTCCTAAGTTGATT
GTGGATTCCTTTCAAGAGAAGAAAATCATCTCCTTTAATGGGTGTATGGCTCAAGCCTAT
GCAGAACACATTTTTGGTGCTACTGAGATCATCCTGCTGACAGTGATGGCCTGTGACTGC
TATGTGGCCATCTGCAAACCTCTGAACTACACAACCATTATGAGCCACAGCCTGTGCATT
CTCCTGGTGGCAGTGGCCTGGGTGGGAGGATTTCTTCATGCAACTATTCAGATTCTCTTT
ACAGTATGGCTGCCCTTCTGTGGCCCCAATGTCATAGGCCACTTCATGTGTGACTTGTAC
CCATTGTTAAAACTTGTTTGCATAGACACTCATACCCTTGGTCTCTTTGTTGCTGTGAAC
AGTGGGTTTATCTGCTTATTAAACTTCCTTATCTTGGTGGTATCCTATGTGATCATCTTG
AGATCTTTAAAGAACAATAGCTTGGAGGGGAGGTGTAAAGCCCTCTCCACCTGTATTTCT
CACATCATAGTAGTTGTCTTATTCTTTGTGCCCTGTATATTTGTGTATCTGCGCTCAGTG
ACCACTCTGCCCATTGATAAAGCTGTTGCTGTATTTTATACTATGGTGGTCCCAATGTTA
AATCCCGTGGTCTACACACTCAGAAATGCTGAGGTAAAAAGTGCAATAAGGAAGCTTTGG
AGAAAAAAAGTGACTTCAGATAATGAT
Conceptual translation MEKKKNVTEFILIGLTQNPIMEKVTFVVFLVLYMITLSGNLLIVVTITTSQALSSPMYFF
LTHLSLIDTVYSSSSAPKLIVDSFQEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDC
YVAICKPLNYTTIMSHSLCILLVAVAWVGGFLHATIQILFTVWLPFCGPNVIGHFMCDLY
PLLKLVCIDTHTLGLFVAVNSGFICLLNFLILVVSYVIILRSLKNNSLEGRCKALSTCIS
HIIVVVLFFVPCIFVYLRSVTTLPIDKAVAVFYTMVVPMLNPVVYTLRNAEVKSAIRKLW
RKKVTSDND

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/A V/L 1000GP (YRI, YRI)
11 49,981,655 49,981,655 NS C/A V/L 1000GP (CEU, CHBJPT)
11 50,003,191 50,003,191 NS C/A V/L rs4598671 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V283L V269L R258C T190I % Freq CORP
1 L V R T 49.85 0.400
2 V V R T 49.62 0.400
3 L V C T 0.31 0.400
4 V V R I 0.15 0.400
5 V L R T 0.08 0.400

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C12.aApr07-unspliced main_exon 3UTR chr11 49,981,572 49,981,575 -
CDS chr11 49,981,575 49,982,501 -