Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C13 Olfactory Receptor

Gene Symbol OR4C131 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-260, HsOR11.9.4, ORL3336
External Ids HGNC: 15169   GeneBank: AB065750, AF399575, BK004414, NM_001001955   ORDB: ORL3336   
Build #39 labels OR4C13
Chromosomal location 11:49,952,423-49,953,349 (+)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C7P 90.94% 309
OR4C9P 90.16% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C10 82% 309
Dog OR4C10C 81% 309
Chimp CONTIG7566.1-618 97% 309
Mouse Or4c10 83% 303
Rat Or4c10b 80% 309
Cow OR4C10 81% 303
Cow OR4C10G 81% 308

Expression evidences

Source Accession
mRNA BC137005
GNF Atlas2 gnf1h02094_s_at

Sequence information

Nucleotide sequence ATGGCGAATAGAAACAATGTGACAGAGTTTATTCTATTGGGGCTTACAGAGAATCCAAAA
ATGCAGAAAATCATATTTGTTGTGTTTTCTGTCATCTACATCAACGCCATGATAGGAAAT
GTGCTCATTGTGGTCACCATCACTGCCAGCCCATCACTGAGATCCCCCATGTACTTTTTC
CTGGCCTATCTCTCCTTTATTGATGCCTGCTATTCCTCTGTCAATACCCCTAAGCTGATC
ACAGATTCACTCTATGAAAACAAGACTATCTTATTCAATGGATGTATGACTCAAGTCTTT
GGAGAACATTTTTTCAGAGGTGTTGAGGTCATCCTACTTACTGTAATGGCCTATGACCAC
TATGTGGCCATCTGCAAGCCCTTGCACTATACCACCATCATGAAGCAGCATGTTTGTAGC
CTGCTAGTGGGAGTGTCATGGGTAGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTC
ATCTGTCAATTACCTTTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTCTAC
ACTTTGATCAATCTTGCCTGCACTAATACCCACACTCTAGGACTCTTCATTGCTGCCAAC
AGTGGGTTCATATGCCTGTTAAACTGTCTCTTGCTCCTGGTCTCCTGCGTGGTCATACTG
TACTCCTTAAAGACCCACAGCTTAGAGGCAAGGCACGAAGCCCTCTCTACCTGTGTCTCC
CACATCACAGTTGTCATCTTATCCTTTATACCCTGCATATTTGTGTACATGAGACCTCCA
GCTACTTTACCCATTGATAAAGCAGTTGCTGTATTCTACACTATGATAACTTCTATGTTA
AACCCCTTAATCTACACCTTGAGGAATGCTCAAATGAAAAATGCCATTAGGAAATTGTGT
AGTAGGAAAGCTATTTCAAGTGTCAAA
Conceptual translation MANRNNVTEFILLGLTENPKMQKIIFVVFSVIYINAMIGNVLIVVTITASPSLRSPMYFF
LAYLSFIDACYSSVNTPKLITDSLYENKTILFNGCMTQVFGEHFFRGVEVILLTVMAYDH
YVAICKPLHYTTIMKQHVCSLLVGVSWVGGFLHATIQILFICQLPFCGPNVIDHFMCDLY
TLINLACTNTHTLGLFIAANSGFICLLNCLLLLVSCVVILYSLKTHSLEARHEALSTCVS
HITVVILSFIPCIFVYMRPPATLPIDKAVAVFYTMITSMLNPLIYTLRNAQMKNAIRKLC
SRKAISSVK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SYN C/T H/H 1000GP (YRI)
11 49,952,427 49,952,427 NS C/T A/V 1000GP (CEU, CHBJPT)
11 49,953,097 49,953,097 SYN C/T T/T 1000GP (CEU)
11 49,953,118 49,953,118 SYN C/T H/H 1000GP (CEU, CHBJPT)
11 49,953,123 49,953,123 NS C/T A/V 1000GP (CEU)
11 49,973,979 49,973,979 NS C/T A/V rs28378220 (DbSNP)
11 49,974,371 49,974,371 NS A/G I/V rs28662375 (DbSNP)
11 49,974,400 49,974,400 SYN A/T L/L rs4268488 (DbSNP)
11 49,974,670 49,974,670 SYN C/T H/H rs16914589 (DbSNP)
11 49,974,822 49,974,821 Ins(2) -/CT rs71973814 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A2V V133I C167R L185V A234V % Freq CORP
1 A I C L A 91.01 1.000
2 V I C L A 7.68 1.000
3 A I R L A 0.84 1.000
4 V V C L A 0.15 1.000
5 A I C V A 0.15 1.000
6 A I C L V 0.08 1.000
7 A V C L A 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C13.aApr07-unspliced main_exon CDS chr11 49,952,423 49,953,349 +
3UTR chr11 49,953,349 49,953,352 +