Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C14P Olfactory Receptor

Gene Symbol OR4C14P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-129, HsOR11.11.14P, ORL3654
External Ids HGNC: 15170   GeneBank: BK004779, NG_004234   ORDB: ORL3654   
Build #39 labels OR4C14P
Chromosomal location 11:55,537,002-55,537,924 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C6 69.26% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C59 72% 308
Chimp CONTIG4260.2-9297 93% 309
Mouse Or4c123 71% 305
Rat Or4c102 71% 305
Cow OR4C163P 65% 314

Sequence information

Nucleotide sequence ATGGGGACTTCAAATAATGAGACTGAATTCATTCTTTTGGGCATTACAAAAAATCCAGAA
CTAAGGAAAATATTCTCTGCTTTGTTTCTAGCCATGTATGTGACCACAGTGTTGGGAAAT
CTATTCATTGTGGTGACTCTGGCTGCAAGTTGGAGTCTGAGATCACCTATGTACTTTTCC
CTTACTTCCTTGTCTCTCATGGGTGCCACCTACTCTTCCATCACTGCCCCTAAGATGACT
GTGGACTCTTTGAGAACACTACCATTTCCCTTGAAGGCTGCATGACCCAGCTCTTTGCAG
AGCATTTCTCTGATGGTGTAGCGATCATCCTTCTCACTGTGATGGTCTGTGACTGCTATG
AGGCCATCAGTAAGCCCCTGCATGACACAACCATCATGAGTCCACGGGTGTGCTGCTGTT
GGTGGTAGAAGCTTGGGTGGGGGGATTAACACATGCCACAATACAGCTTTTTTTTTTTCA
TATATCAAATACCCTTCTGTGGTCCCAATATTATTGACCATTTTATATGTGATTTGTTTC
CATTGTTAAAACTTGCTTACATGGACACCCACATGCTGGGTCTCTTAGTCATCCTCAACA
GTGGGGTGATGTGTATGGCCATCTTCCTTATCCTAATTGCATCCTACATTGTCACCCTGT
ACTCTCTGAAGTCTTGCAGCTCGGTAGGTTGACGCAACACACTTTCCACCTGTGGCTCCC
ACCACACAGTGGTCATCTTGTTCTTCGTGGAGTGTATTTTCTTGTACATAAGACCTGTGG
TCACTTACCCCATAGACAAGGATATGGCTATTTCCTTTACTATTGTTGCACCCATGTTAA
ATCCTCTGATCTATACCCTGAGGGGCATCAAGGTAAAAAATGCCATAAGAAAAATGTGGA
TGAAACAGGGGACCCTAGGTGGT
Conceptual translation MGTSNNETEFILLGITKNPELRKIFSALFLAMYVTTVLGNLFIVVTLAASWSLRSPMYFS
LTSLSLMGATYSSITAPKMTV/LFENTTISLEGCMTQLFAEHFSDGVAIILLTVMVCDC
YEAISKPLHDTTIMSPRVC/LLVVEAWVGGLTHATIQLFFF\YQIPFCGPNIIDHFIC
DLFPLLKLAYMDTHMLGLLVILNSGVMCMAIFLILIASYIVTLYSLKSCSSVGXNTLST
CGSHHTVVILFFVECIFLYIRPVVTYPIDKDMAISFTIVAPMLNPLIYTLRGIKVKNAIR
KMWMKQGTLGG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 55,304,647 55,304,647 SNP G/T rs1459103 (DbSNP)
11 55,304,719 55,304,719 SNP G/T rs11823379 (DbSNP)
11 55,304,835 55,304,835 SNP A/G rs11230088 (DbSNP)
11 55,304,945 55,304,944 Ins(1) -/T rs5791950 (DbSNP)
11 55,304,946 55,304,945 Ins(1) -/T rs71786600 (DbSNP)
11 55,304,962 55,304,962 SNP C/T rs56266612 (DbSNP)
11 55,305,160 55,305,160 SNP G/T rs61917926 (DbSNP)
11 55,305,167 55,305,167 SNP C/T rs474915 (DbSNP)
11 55,305,170 55,305,170 SNP C/T rs61917927 (DbSNP)
11 55,305,250 55,305,250 SNP A/G rs34099327 (DbSNP)
11 55,305,297 55,305,297 SNP C/T rs12277428 (DbSNP)
11 55,305,322 55,305,322 SNP C/T rs35968796 (DbSNP)
11 55,537,171 55,537,171 SNP T/G 1000GP (CEU, CHBJPT)
11 55,537,359 55,537,359 SNP A/G 1000GP (CEU, CHBJPT)
11 55,537,486 55,537,486 SNP T/C 1000GP (CEU)
11 55,537,684 55,537,684 SNP G/T 1000GP (CEU)
11 55,537,691 55,537,691 SNP T/C 1000GP (CEU, CHBJPT)
11 55,537,694 55,537,694 SNP C/T 1000GP (CEU)
11 55,537,774 55,537,774 SNP A/G 1000GP (CEU)
11 55,537,846 55,537,846 SNP T/C 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,276,602 55,355,722 CopyNumber Variation_9186 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.