Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C16 Olfactory Receptor

Gene Symbol OR4C161 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score
Aliases OR11-135, HsOR11.11.16, ORL3435
External Ids HGNC: 15172   GeneBank: AB065773, BK004504, NM_001004701   ORDB: ORL3435   
Build #39 labels OR4C16
Chromosomal location 11:55,572,128-55,573,057 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs1459101 (AA change=Q/*)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C11 67.31% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C146 77% 310
Chimp CONTIG970.77-5062 95% 310
Mouse Or4c29 77% 310
Rat Or4c29 76% 310
Cow OR4C146 78% 310

Sequence information

Nucleotide sequence ATGCAACTGAATAATAATGTGACTGAGTTCATTCTGCTTGGATTGACACAGGATCCTTTT
TGGAAGAAAATAGTGTTTGTTATTTTTTTGCGTCTCTACTTGGGAACACTGTTGGGTAAT
TTGCTAATCATTATTAGTGTCAAGACCAGCCAGGCACTTAAGAACCCAATGTTCTTCTTC
CTTTTCTACTTATCCTTATCTGATACTTGCCTCTCTACTTCCATAACCCCTAGAATGATT
GTGGATGCCCTTTTGAAGAAGACAACTATCTCCTTCAGCGAGTGCATGATCCAAGTCTTT
TCATCCCATGTCTTTGGCTGCCTGGAGATCTTCATCCTCATCCTCACGGCTGTTGACCGC
TATGTGGACATCTGTAAGCCCCTGCACTACATGACCATCATAAGCCAGTGGGTCTGTGGT
GTTTTGATGGCTGTGGCCTGGGTGGGATCCTGTGTGCATTCTTTAGTTCAGATTTTTCTT
GCCCTGAGTTTGCCATTCTGTGGCCCCAATGTGATCAATCACTGTTTCTGTGACTTGCAG
CCCTTGTTGAAACAAGCCTGTTCAGAAACCTATGTGGTTAACCTACTCCTGGTTTCCAAT
AGTGGGGCCATTTGTGCAGTGAGTTATGTCATGCTAATATTCTCCTATGTCATCTTCTTG
CATTCTCTGAGAAACCACAGTGCTGAAGTGATAAAGAAAGCACTTTCCACATGTGTCTCC
CACATCATTGTGGTCATCTTGTTCTTTGGACCTTGCATATTTATGTACACATGCCTTGCA
ACCGTATTCCCCATGGATAAGATGATAGCTGTATTTTATACAGTTGGAACATCTTTTCTC
AACCCTGTGATTTACACGCTGAAGAATACAGAAGTGAAAAGTGCCATGAGGAAGCTTTGG
AGCAAGAAATTGATCACAGATGACAAAAGA
Conceptual translation MQLNNNVTEFILLGLTQDPFWKKIVFVIFLRLYLGTLLGNLLIIISVKTSQALKNPMFFF
LFYLSLSDTCLSTSITPRMIVDALLKKTTISFSECMIQVFSSHVFGCLEIFILILTAVDR
YVDICKPLHYMTIISQWVCGVLMAVAWVGSCVHSLVQIFLALSLPFCGPNVINHCFCDLQ
PLLKQACSETYVVNLLLVSNSGAICAVSYVMLIFSYVIFLHSLRNHSAEVIKKALSTCVS
HIIVVILFFGPCIFMYTCLATVFPMDKMIAVFYTVGTSFLNPVIYTLKNTEVKSAMRKLW
SKKLITDDKR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 nonsense SNP C/T Q/* 1000GP (YRI)
11 100 -100 NS G/T V/L 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T Y/Y 1000GP (YRI, YRI, YRI)
11 55,339,652 55,339,652 nonsense SNP T/C */Q rs1459101 (DbSNP)
11 55,339,676 55,339,676 NS G/T V/L rs12800642 (DbSNP)
11 55,339,702 55,339,702 SYN C/T Y/Y rs34100491 (DbSNP)
11 55,339,748 55,339,748 NS G/A A/T rs558465 (DbSNP)
11 55,339,798 55,339,798 SYN C/T S/S rs557667 (DbSNP)
11 55,339,829 55,339,829 NS A/G T/A rs557590 (DbSNP)
11 55,340,170 55,340,170 NS A/C E/D rs61916568 (DbSNP)
11 55,340,210 55,340,210 NS A/G T/A rs12288690 (DbSNP)
11 55,340,379 55,340,379 NS C/T P/L rs559449 (DbSNP)
11 55,340,466 55,340,466 NS A/G K/R rs56111016 (DbSNP)
11 55,572,176 55,572,176 nonsense SNP C/T Q/* 1000GP (CEU, CHBJPT)
11 55,572,200 55,572,200 NS G/T V/L 1000GP (CEU, CHBJPT)
11 55,572,226 55,572,226 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
11 55,572,228 55,572,228 NS T/G L/W 1000GP (CEU)
11 55,572,236 55,572,236 SYN C/T L/L 1000GP (CEU)
11 55,572,264 55,572,264 NS G/C S/T 1000GP (CEU)
11 55,572,322 55,572,322 SYN C/T S/S 1000GP (CEU)
11 55,572,353 55,572,353 NS A/G T/A 1000GP (CEU, CHBJPT)
11 55,572,372 55,572,372 NS A/G D/G 1000GP (CEU)
11 55,572,694 55,572,694 NS A/C E/D 1000GP (CEU)
11 55,572,903 55,572,903 NS T/C L/P 1000GP (CEU, CHBJPT)
11 55,572,990 55,572,990 NS A/G K/R 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,276,602 55,355,722 CopyNumber Variation_9186 (DGV)
11 55,335,878 55,453,486 CopyNumber Variation_48051 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,339,829 55,447,427 CopyNumber Variation_53140 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q17* V25L L34W S46T K48T T49A T76A D82G V152M E189D A203T V239I L259P K288R % Freq CORP
1 Q V L S K T A D V E A V L K 36.64 1.000
2 * V L S K T A D V E A V P K 27.57 1.200
3 Q L L S K T A D V E A V P K 17.67 1.000
4 Q V L S K T T D V E A V L K 10.37 1.000
5 Q V W T K T A D V D A V P R 2.30 1.000
6 Q V L S K T A D V E A V P K 2.07 1.000
7 Q V L S K T T D V E T V L K 1.00 1.000
8 Q V L S K T A D V E A I L K 0.54 1.000
9 Q V L S K A A D V E A V P K 0.38 1.000
10 Q V L S K T A D M E A V L K 0.31 1.000
11 Q L L S K T A D V E A V L K 0.15 1.000
12 Q V W T T T A D V D A V P R 0.15 1.000
13 Q V L S K T A G V E A V L K 0.15 1.000
14 Q V L S K T A D V E T V L K 0.08 1.000
15 Q V L T K T T D V E A V L K 0.08 1.000
16 * V L T K T A D V D A V P R 0.08 1.200
17 Q V W T K T A D V D A V P K 0.08 1.000
18 * V L S K T A D V D A V P K 0.08 1.200
19 Q V L T K T A D V D A V P K 0.08 1.000
20 Q V W S K T T D V E A V L R 0.08 1.000
21 * V W T K T A D V D A V P R 0.08 1.200
22 * V L S K T T D V E A V P K 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C16.aApr07-unspliced main_exon CDS chr11 55,572,128 55,573,057 +
3UTR chr11 55,573,057 55,573,060 +