Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C1P Olfactory Receptor

Gene Symbol OR4C1P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-128, OR11-125, HSHTPCRX11, HsOR11.11.13P, ORL3653
External Ids HGNC: 8292   GeneBank: AF546462-AF546475, BK004572, BK004769, HSHTPRX11, NG_002184   ORDB: ORL3653   
Build #39 labels OR4C1P
Chromosomal location 11:55,509,729-55,510,662 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A2P 64.21% 299
OR4C10P 64.21% 299
OR4C9P 63.88% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C1 88% 305
Chimp CONTIG2667.10-1637 97% 210
Mouse Or4c1 85% 308
Rat Or4c1 85% 308
Cow OR4C1 79% 308
Cow OR4C1B 83% 307

Expression evidences

Source Accession
mRNA X64985

Sequence information

Nucleotide sequence ATGGATCACCACATGCCTCCCAACAATGTGACTGAATTCATTCTCTTGGGGCTCACACAG
AATCCACACTTGCAGAAAATACTCTTTATTGTATTTTTATTTATTTTTCTATTTACCATG
CTGGCCAATCTGTTCATTGTCATCACCATCTCCTGTAGCCCCACACTTTCATCACCCATG
TACTTCTTTCTCACTTACTTATCCTTTATAGATGCCTCCTACACCTCTGTCACAACCCCC
AAAATGATCACCGACCTGCTCTACCAGAGGAGAACTATTTCCTTGGCTGGCTGCCTGACT
CAGCTCTTTGTGGAGCACTTGCTGGGAGGCTCAGAGATCATCCTCCTTATTGTCATGGCC
TATGACCGCTACGTGGCCATCTGCAAGCCCCTGCACTACACAACCATTATGCAACAAGGG
ATCTGCCACCTTCTGGTGGTGATAGCCTGGATTGGAGGCATCCTGCATGCCACTGTGCAG
ATTCTTTTCATGACCGACTTGCCCTTCTGTGGTCCCCAATGTCATTGACCACTTTATGTG
TGATCTCTTCCCATTGTTGAAACTTGCCTGCAGAGACACCTACAGACTTGGGATGCTGGT
GGCAGCCAACAGTGGAGCCATGTGCTTGCTCATCTTTTCCCTGCTCGTCATCTCCTACAT
AGTCATCCTGAGCTCCCTGAAATCCTATAGCTCTGAAGGACAGCACAAAGCCCTCTCCAC
CTGTGGCTCCCACTTTACTGTCGTTGTACTCTTTTTTGTGCCTTGCATATTCACCTACAT
GCATCCTGTGGTCACCTACTCTGTGGACAAGTTGGTGACTGTGTTCTTTGCAATCCTCAC
TCCCATGTTAAATCCTATAATTTACACTGTGAGAAACACAGAGGTAAAAAATGCCGTGAG
GAGTTTGTTGAGGAAAAGAGTAACAGTTTATGCA
Conceptual translation MDHHMPPNNVTEFILLGLTQNPHLQKILFIVFLFIFLFTMLANLFIVITISCSPTLSSPM
YFFLTYLSFIDASYTSVTTPKMITDLLYQRRTISLAGCLTQLFVEHLLGGSEIILLIVMA
YDRYVAICKPLHYTTIMQQGICHLLVVIAWIGGILHATVQILFMTDLPFCGP\VIDHFM
CDLFPLLKLACRDTYRLGMLVAANSGAMCLLIFSLLVISYIVILSSLKSYSSEGQHKALS
TCGSHFTVVVLFFVPCIFTYMHPVVTYSVDKLVTVFFAILTPMLNPIIYTVRNTEVKNAV
RSLLRKRVTVYA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,277,617 55,277,617 SNP A/G rs17579825 (DbSNP)
11 55,277,806 55,277,806 SNP A/G rs73467531 (DbSNP)
11 55,278,098 55,278,098 SNP C/T rs552884 (DbSNP)
11 55,277,761 55,277,761 SNP C/T rs17494990 (DbSNP)
11 55,277,908 55,277,908 SNP C/T rs34008069 (DbSNP)
11 55,277,909 55,277,909 SNP G/A rs495119 (DbSNP)
11 55,278,100 55,278,100 SNP G/T rs17579895 (DbSNP)
11 55,510,141 55,510,141 SNP A/G 1000GP (CEU)
11 55,510,285 55,510,285 SNP T/C 1000GP (CEU)
11 55,510,432 55,510,432 SNP C/T 1000GP (CEU, CHBJPT)
11 55,510,433 55,510,433 SNP A/G 1000GP (CEU, CHBJPT)
11 55,510,484 55,510,484 SNP T/C 1000GP (CEU)
11 55,510,624 55,510,624 SNP G/T 1000GP (CEU)
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)
11 55,276,602 55,355,722 CopyNumber Variation_9186 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C1P.aApr07-unspliced main_exon CDS_partial chr11 55,510,106 55,510,444 +