Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C2P Olfactory Receptor

Gene Symbol OR4C2P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-102, OR11-103, HsOR11.8.10P, ORL3739
External Ids HGNC: 14696   GeneBank: AB065547, AB065568, BK004694, BK004807   ORDB: ORL3739   
Build #39 labels OR4C2P
Chromosomal location 11:48,420,244-48,421,171 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C12 88.35% 309
OR4C50P 90.29% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C12 84% 309
Dog OR4C12C 83% 309
Chimp CONTIG2320.6-3538 97% 309
Mouse Or4c12 82% 309
Mouse Or4c12b 82% 304
Rat Or4c12 83% 303
Rat Or4c12b-ps 82% 302
Cow OR4C12 81% 309
Cow OR4C12DP 82% 276

Sequence information

Nucleotide sequence ATGAAGAATAAAAGGAATGTGACTGAATTCGTTTTAACAGGTCTTACACAGAACCCTAAA
ATGGAGAAAGTCATGTTTGCAGTATTTTTGGTTCTTTACATGATAACACTTTCAGGCAAC
CTGCTCCTTGTGGTTACAATTACCACCAGCCAGGCTCTTAGCTCCCCCATGTACTTCTTC
CTGAGCCACCTTTCTTTGATAGACACAGTTTATTCTTCTTCTTCAGCTCCTAAGTTGATT
GTCGATTCCCTTCATGAGAAGAAAATCATCTCCTTTAATGGGTGTATGGCTCAAGCCTAT
GAAGAACACATTTTTGGTGCTACTGAGATCATCCTGCTGACAGTGATGGCCTGTGACAAC
TATGTGGCCATCTGCAAACCTCTGCACTACACAACCATCATGAGCCACAGCCTGTGCATT
CTCCTAGTGGTAGTGGCCTGGATAGGAGGATTTCTCCATGCAAATATTCAGATTCTATTT
ACAGTATGGCTGCCCTTCTGTGGCCCCAATGTCATAGACCACTTCATGTGTGACTTGTGC
CCTTTGTTAAAACTTGTTTGCCTGGACACTCATACCCTTGGTCTCTTTGTTGCTGCCAAC
AGTGGGTTCATCTGCTTATTAAACTTCCTTCTCTAGGTGGTATCCTATGTGATCATCTTG
AGATGTTTAAAGAACTATATCTTGGAGGGGAGGGGTAAAGCCCTCTCCACCTGTATTTCT
CACATCATAATAGTTGTCTTATTCTTTGTGCCTTGTATATTTGTGTATCTGCACCCAGTG
ACAAACTCTGCCCATTGATAAAGCTGCTGCTGTATTTTATACTATGGTGGTCCCAATGTT
AAATCCTTTGATCTACACACTCAGAAATGCTGAGGTAAAAAGTGCAATAAGGAAGCTTTG
GAGAAAAAAAGTTATTTCAGATAATGAC
Conceptual translation MKNKRNVTEFVLTGLTQNPKMEKVMFAVFLVLYMITLSGNLLLVVTITTSQALSSPMYFF
LSHLSLIDTVYSSSSAPKLIVDSLHEKKIISFNGCMAQAYEEHIFGATEIILLTVMACDN
YVAICKPLHYTTIMSHSLCILLVVVAWIGGFLHANIQILFTVWLPFCGPNVIDHFMCDLC
PLLKLVCLDTHTLGLFVAANSGFICLLNFLLXVSYVIILRCLKNYILEGRGKALSTCIS
HIIIVVLFFVPCIFVYLHPVTN\PIDKAAAVFYTMVVPMLNPLIYTLRNAEVKSAIRKL
WRKKVISDND

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 48,441,811 48,441,810 Ins(1) -/G rs34816197 (DbSNP)
11 48,441,837 48,441,836 Ins(1) -/G rs35924957 (DbSNP)
11 48,442,264 48,442,264 SNP A/C rs61917511 (DbSNP)
11 48,441,874 48,441,874 SNP C/G rs4882060 (DbSNP)
11 48,420,322 48,420,322 SNP G/C 1000GP (CEU, CHBJPT)
11 48,420,701 48,420,701 SNP A/T 1000GP (CEU)
11 48,420,712 48,420,712 SNP C/A 1000GP (CEU)
11 100 -100 SNP G/C 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
CopyNumber 7 (Hasin)
11 48,441,696 48,444,723 Deletion #202 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.