Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C3 Olfactory Receptor

Gene Symbol OR4C31 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-98, HsOR11.8.6, ORL3738
External Ids HGNC: 14697   GeneBank: AB065567, BK004349, NM_001004702   ORDB: ORL3738   
Build #39 labels OR4C3
Chromosomal location 11:48,325,022-48,325,927 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C49P 92.38% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C3 86% 301
Chimp CONTIG1131.66-544 98% 302
Chimp CONTIG2000.15-9349 93% 302
Mouse Or4c3 85% 301
Rat Or4c3 84% 301
Cow OR4C3 84% 301

Expression evidences

Source Accession
mRNA BC136854

Sequence information

Nucleotide sequence ATGGACATACCACAAAATATCACAGAATTTTTCATGCTGGGGCTCTCACAGAACTCAGAG
GTACAGAGAGTTCTCTTTGTGGTCTTTTTGCTGATCTATGTGGTCACGGTTTGTGGCAAC
ATGCTCATTGTGGTCACTATCACCTCCAGCCCCACGCTGGCTTCCCCTGTGTATTTTTTC
CTGGCCAACCTATCCTTTATTGACACCTTTTATTCTTCTTCTATGGCTCCTAAACTCATT
GCTGACTCATTGTATGAGGGGAGAACCATCTCTTATGAGTGCTGCATGGCTCAGCTCTTT
GGAGCTCATTTTTTGGGAGGTGTTGAGATCATTCTGCTCACAGTGATGGCTTATGACCGC
TATGTGGCCATCTGTAAGCCCCTGCACAATACTACCATCATGACCAGGCATCTCTGTGCC
ATGCTTGTAGGGGTGGCTTGGCTTGGGGGCTTCCTGCATTCATTGGTTCAGCTCCTCCTG
GTCCTTTGGTTGCCCTTCTGTGGGCCCAATGTGATCAATCACTTTGCCTGTGACTTGTAC
CCTTTGCTGGAAGTTGCCTGCACCAATACGTATGTCATTGGTCTGCTGGTGGTTGCCAAC
AGTGGTTTAATCTGCCTGTTGAACTTCCTCATGCTGGCTGCCTCCTACATTGTCATCCTG
TACTCCTTGAGGTCCCACAGTGCAGATGGGAGATGCAAAGCCCTCTCCACCTGTGGAGCC
CACTTCATTGTTGTTGCCTTGTTCTTTGTGCCCTGTATATTTACTTATGTGCATCCATTT
TCTACTTTACCTATAGACAAAAATATGGCATTATTTTATGGTATTCTGACACCTATGTTG
AATCCACTCATTTATACCCTGAGAAATGAAGAGGTAAAAAATGCCATGAGAAAGCTCTTT
ACATGG
Conceptual translation MDIPQNITEFFMLGLSQNSEVQRVLFVVFLLIYVVTVCGNMLIVVTITSSPTLASPVYFF
LANLSFIDTFYSSSMAPKLIADSLYEGRTISYECCMAQLFGAHFLGGVEIILLTVMAYDR
YVAICKPLHNTTIMTRHLCAMLVGVAWLGGFLHSLVQLLLVLWLPFCGPNVINHFACDLY
PLLEVACTNTYVIGLLVVANSGLICLLNFLMLAASYIVILYSLRSHSADGRCKALSTCGA
HFIVVALFFVPCIFTYVHPFSTLPIDKNMALFYGILTPMLNPLIYTLRNEEVKNAMRKLF
TW

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 48,346,669 48,346,677 In-Del(9) -/GATCAGCAA rs34634151 (DbSNP)
11 48,347,014 48,347,014 nonsense SNP A/G */W rs72473368 (DbSNP)
11 48,346,579 48,346,579 NS A/C E/D rs72911452 (DbSNP)
11 48,347,067 48,347,067 NS C/T P/L rs73464001 (DbSNP)
11 48,347,223 48,347,223 NS C/T T/I rs61735142 (DbSNP)
11 48,347,100 48,347,100 NS C/T A/V rs73465905 (DbSNP)
11 48,347,267 48,347,267 NS C/T R/C rs73465910 (DbSNP)
11 48,346,791 48,346,791 NS C/T S/F rs73463994 (DbSNP)
11 48,346,946 48,346,946 NS C/T R/C rs61744624 (DbSNP)
11 48,346,996 48,346,996 NS G/A M/I rs12794960 (DbSNP)
11 48,347,306 48,347,306 NS G/T V/F rs73465911 (DbSNP)
11 48,346,822 48,346,822 SYN A/C S/S rs73463997 (DbSNP)
11 48,346,615 48,346,615 SYN A/G G/G rs73463988 (DbSNP)
11 48,347,419 48,347,419 SYN A/G P/P rs73465913 (DbSNP)
11 48,346,729 48,346,729 SYN C/G T/T rs73463990 (DbSNP)
11 48,347,023 48,347,023 SYN C/T G/G rs67077733 (DbSNP)
11 48,346,924 48,346,924 SYN C/T A/A rs72911454 (DbSNP)
11 48,347,140 48,347,140 SYN C/T N/N rs10838874 (DbSNP)
11 48,346,843 48,346,843 SYN C/T I/I rs73463998 (DbSNP)
11 48,346,999 48,346,999 SYN G/T L/L rs72473367 (DbSNP)
11 48,325,578 48,325,578 NS C/G A/G 1000GP (CEU)
11 48,325,806 48,325,806 NS C/T T/I 1000GP (CEU, CHBJPT)
11 48,325,794 48,325,794 NS A/T H/L 1000GP (CEU, CHBJPT)
11 48,325,588 48,325,588 SYN T/C N/N 1000GP (CEU)
11 48,325,811 48,325,811 NS C/T P/S 1000GP (CEU, CHBJPT)
11 48,325,129 48,325,129 SYN G/A T/T 1000GP (CEU, CHBJPT)
11 48,325,177 48,325,177 SYN G/C T/T 1000GP (CEU, CHBJPT)
11 48,325,052 48,325,052 NS T/G F/V 1000GP (CEU, CHBJPT)
11 48,325,027 48,325,027 NS C/A D/E 1000GP (CHBJPT)
11 48,325,036 48,325,036 NS A/C Q/H 1000GP (CHBJPT)
11 48,325,063 48,325,063 SYN G/A G/G 1000GP (CHBJPT)
11 48,325,790 48,325,790 NS G/A V/M 1000GP (CHBJPT)
11 48,325,840 48,325,840 SYN T/C Y/Y 1000GP (CHBJPT)
11 48,325,867 48,325,867 SYN A/G P/P 1000GP (CHBJPT)
11 100 -100 NS C/A D/E 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A G/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
CopyNumber 6 (Hasin)
11 48,346,474 48,349,479 CopyNumber #175 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V284M H285L P291S % Freq CORP
1 V H P 43.01 1.000
2 M L S 27.11 1.000
3 M L P 14.98 1.000
4 V H S 14.90 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C3.aApr07-unspliced main_exon 5UTR chr11 48,324,941 48,325,022 +
CDS chr11 48,325,022 48,325,927 +
3UTR chr11 48,325,927 48,325,930 +