Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C45 Olfactory Receptor

Gene Symbol OR4C451 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.65 (pseudogene)
Aliases HsOR11.9.7
External Ids HGNC: 31270   GeneBank: NM_001005513   
Build #39 labels
Chromosomal location :- ()
Cluster
Synteny CLIC#26
Remarks no location in hg. 19

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C10P 65.08% 295
OR4C46 61.97% 305
OR4C5 62.13% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C45 82% 306
Dog OR4C45B 81% 306
Chimp CONTIG2000.11-2742 98% 306
Mouse Or4c126 78% 305
Rat Or4c52 77% 306
Cow OR4C189P 76% 298

Sequence information

Nucleotide sequence ATGAACAATGTAACAGAATTCATCCTGCTGGGCCTCACTCACAATCCAGAACTGCAGAAA
TTCCTGTTTGTTATGTTTTTAATCACCTACTTGATCACACTGGCAGGTAACCTGCTCATC
TCAGTCATCATCTTCATCAGCCCAGCCCTGGGTTCCCCCATGTACCTTTTTCTGTCCTAT
TTATCCATTATAGATATTTTCTACTCTTCTTCCATAGCCCCTAAAATGATCTTTGACTTG
ATCTCTGAAAACAACACCATATCCTTCAATGGCTGCATGACTCAGCTCTTCACAGAACAT
TTCTTTGCGGCAGCTGAGACCATCTTATTAAGTGTCATGGCCTACGACTGCTATGTGGCC
ATCTGTAAGCCCTTGCACTATGCAACCATCATGACCCAATCTATGTGTGGATTCCTGATG
GTGGTGGCTGGAATTCTGGGATTTGTGCATGGAGGAATCCAGACTTTGTTCATAGCCCAG
TTACCATTCTGTGGCCCCAATGTCATCGACCACTTTATGTGTGATTTAGTACCTCTTCTG
GAGCTGGCCTGCACAGACACTCACACTTTAGGGCCTCTGATTGCTGCCAACAGTGGGTCA
CTGTGTTTCCTCATTTTTTCCATACTGGATGCTTCCTATGTCATCATCTTGTGCTCCCTA
AGGTCTCATAGCTCTGAAGGGCATCTCAAAGCTCTGTCTAGTTGTGCCTCTCATATCTTC
ACTGTCATCTTATTCTTTGTCCCTTGTTCATACCTGTATCTAAGACCTCTAACCTCCTTC
CCCACTGACAAAGCTGTGACTGTGTTTTGCACCCTATTTACACCTATGTTGAACCCTTTA
ATCTACACTGTCAAAAATAAAGCAGTGAAAAATGTCATTAAGAAGCTCTGGAAGCAAATA
ATGACAACTGATGATAAA
Conceptual translation MNNVTEFILLGLTHNPELQKFLFVMFLITYLITLAGNLLISVIIFISPALGSPMYLFLSY
LSIIDIFYSSSIAPKMIFDLISENNTISFNGCMTQLFTEHFFAAAETILLSVMAYDCYVA
ICKPLHYATIMTQSMCGFLMVVAGILGFVHGGIQTLFIAQLPFCGPNVIDHFMCDLVPLL
ELACTDTHTLGPLIAANSGSLCFLIFSILDASYVIILCSLRSHSSEGHLKALSSCASHIF
TVILFFVPCSYLYLRPLTSFPTDKAVTVFCTLFTPMLNPLIYTVKNKAVKNVIKKLWKQI
MTTDDK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A M/I 1000GP (YRI, YRI, YRI)
11 100 -100 SYN T/C I/I 1000GP (YRI, YRI, YRI, YRI, YRI)
11 50,103,012 50,103,012 SYN T/C I/I 1000GP (CEU)
11 50,103,132 50,103,132 SYN C/T P/P 1000GP (CEU, CHBJPT)
11 50,103,144 50,103,144 SYN T/G S/S 1000GP (CEU, CHBJPT)
11 50,103,477 50,103,477 SYN A/G L/L 1000GP (CEU, CHBJPT)
11 50,103,660 50,103,660 SYN C/T S/S 1000GP (CHBJPT)
11 50,103,671 50,103,671 NS C/T P/L 1000GP (CEU, CHBJPT)
11 50,103,754 50,103,754 NS T/A S/T 1000GP (CEU, CHBJPT)
11 50,103,762 50,103,762 SYN A/G T/T 1000GP (CHBJPT)
11 50,103,901 50,103,901 NS C/T H/Y 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.