Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C46 Olfactory Receptor

Gene Symbol OR4C461 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR11.10.8
External Ids HGNC: 31271   GeneBank: NM_001004703   
Build #39 labels
Chromosomal location 11:54,603,071-54,603,997 (+)
Cluster 11@51
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C10P 94.82% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C10 86% 309
Dog OR4C10C 85% 309
Chimp CONTIG2320.5-1229 95% 309
Mouse Or4c10 85% 304
Rat Or4c10b 79% 309
Cow OR4C10 83% 305
Cow OR4C10G 83% 307

Sequence information

Nucleotide sequence ATGGAGAATAGGAATAACATGACAGAGTTTGTTTTGCTGGGGCTTACAGAGAATCCAAAG
ATGCAGAAAATCATATTTGTTGTGTTTTTTGTCATCTATATCATCACTGTGGTGGGATAT
GTGCTCATTGTGGTCACCATCACTGCCAGCCCATCACTGGGGTCCCCCATGTACCTTTCC
CTGGCCTATCTCTCCTTTATTGATGCCTGCTATTCCTCTGTCAATACCCCTAACCTGATC
ACACATTCACTCTATGGAAAGAAGGCCATCCTATTCAATGGATGCATGACTCAAGTCTTT
GGAGAACATTTCTTCGGAGGTGCAGAGGGCATCCTACTTACTGTGATGGCCTATGACCAC
TATGTGGCCATCTGCAAGCCCTTGCACTATATGACTATCATGAACCAGTGTGTGTGTGCC
CTGCTAATGGGAGTGGTGTGGATGGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTC
ATCTTCCAATTACCTTTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTGAAC
CCTTTGCTCAACCTCGCCTGCACTGACACCCATATGCTGGAACTCTTCATTGCTGCCAAC
AGTGGATTCATCTGCTTGTTAAACTTTGCCCTCCTGCTGGTCTCCTATGTGGTCATCTTG
TGCTCCCTAAGGACTCATAGCTTGGAGGCAAGGCACAAAGCCCTCTCCACCTGTGTCTCC
CACATCACGGTTGTCATCTTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCTGCA
GCTACTTTACCTATTGATAAAGCAGTTGCTATATTCTACACTATGATAACTCCTATGTTA
AACCCCTTAATCTATACCTTGAAGAATGCCCAGATGAAAAATGCCATCAGGAAATTGTGT
AGTAGAAAGGACATTTCAGGTGACAAA
Conceptual translation MENRNNMTEFVLLGLTENPKMQKIIFVVFFVIYIITVVGYVLIVVTITASPSLGSPMYLS
LAYLSFIDACYSSVNTPNLITHSLYGKKAILFNGCMTQVFGEHFFGGAEGILLTVMAYDH
YVAICKPLHYMTIMNQCVCALLMGVVWMGGFLHATIQILFIFQLPFCGPNVIDHFMCDLN
PLLNLACTDTHMLELFIAANSGFICLLNFALLLVSYVVILCSLRTHSLEARHKALSTCVS
HITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLKNAQMKNAIRKLC
SRKDISGDK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 51,515,834 51,515,834 NS A/C I/L rs61890422 (DbSNP)
11 51,516,144 51,516,144 NS A/G K/R rs11246609 (DbSNP)
11 51,516,036 51,516,036 NS A/G Y/C rs11246608 (DbSNP)
11 51,515,546 51,515,546 NS A/G T/A rs61890419 (DbSNP)
11 51,515,460 51,515,460 NS C/T S/F rs11246606 (DbSNP)
11 51,516,000 51,516,000 NS C/T S/F rs11246607 (DbSNP)
11 51,515,830 51,515,830 SYN C/G L/L rs61890421 (DbSNP)
11 51,515,596 51,515,596 SYN C/T F/F rs61890420 (DbSNP)
11 54,603,367 54,603,367 NS C/T L/F 1000GP (CEU, CHBJPT)
11 54,603,819 54,603,819 NS C/T S/F 1000GP (CEU)
11 54,603,135 54,603,135 NS A/G K/R 1000GP (CEU)
11 54,603,325 54,603,325 NS A/T T/S 1000GP (CEU)
11 100 -100 NS C/T S/F 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 51,192,824 51,563,636 CopyNumber Variation_8689 (DGV)
11 51,228,146 51,525,878 CopyNumber Variation_48823 (DGV)
11 51,372,036 51,529,002 CopyNumber Variation_53111 (DGV)
11 51,515,182 51,518,208 Deletion #274 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S60F A89T A108V H120R A199T L211F T225S A234V L235H C238R S240F D304N % Freq CORP
1 S A A H A L T A L C F D 44.85 1.000
2 S A A H A L T A L C S D 32.87 1.000
3 F A A R A F T A L C S D 12.44 1.000
4 F T A H A L T A L C S D 3.53 1.000
5 S A A H A L T A L R S D 1.15 1.000
6 F A A H A F T A L C S D 1.08 1.000
7 S A A R A F T A L C S D 0.92 1.000
8 F A A R A F T V L C S D 0.77 1.000
9 S A A H A L T A L C F N 0.54 1.000
10 S T A H A L T A L C S D 0.31 1.000
11 S A V H A L T A L C F D 0.23 1.000
12 S A A H A L S A L C F D 0.23 1.000
13 S A A H A L T A H C S D 0.15 1.000
14 F A A H A L T A L C S D 0.15 1.000
15 S A A R A L T A L C S D 0.15 1.000
16 F T A H A L T A H C S D 0.15 1.000
17 S A A H A L T A L R F D 0.08 1.000
18 S A A H T L T A L C F D 0.08 1.000
19 S A A H A F T A L C S D 0.08 1.000
20 S A A R A L T A L C F D 0.08 1.000
21 S A A H A L T A H C F D 0.08 1.000
22 S T A H A L T A L C F D 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C46.aApr07-unspliced main_exon 3UTR chr11 54,603,068 54,603,071 +
CDS chr11 54,603,071 54,603,997 +