Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C48P Olfactory Receptor

Gene Symbol OR4C48P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.9.6P
External Ids HGNC: 31272   GeneBank: NG_004421   
Build #39 labels
Chromosomal location :- ()
Cluster
Synteny CLIC#0
Remarks no location in hg. 19

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C5 85.39% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C5 80% 308
Chimp CONTIG2000.9-9004 96% 309
Mouse Or4c35 76% 308
Rat Or4c35 78% 302
Cow OR4C5P 75% 307

Sequence information

Nucleotide sequence ATGGAGCAAGTGAACAACGTAACGGAATTTTCTTGCTTGGCCTGACATAGAACACAGGGG
CACAGAAACTCTTGTTTGCTGTGTTTACACTCATCTAATTTCTCACCATGGTAGGCAACC
TACTCATTGTGGTGACAATCACCACCAGCCCAGCCCTGCACTCCCCCATGTATTTTTTTC
TGTCTTTCTTGTCCTTCATAGATGGCTGCTGCTCTTCTACCATGGCCCCCAAAATGATAT
TTAACTTACTCACTGAAAGGAAACTATCTCCTTCAGTGCGTGCATGACCCAGCTCTTTGC
AGAACATTTCTTTGGGAGAGTTGAGATCATTCTGCTCGTGGTAATGGCCTATGACCGCTA
TGAGACAATCTGCAAGCCCCTGTACTACCTGATCACAATGAACAGGAAGGTGTGTGGCCT
ACTGGTGGCCATGGCATGGGCCGGGGGATTTCTTCATGCTCTGATTCAAATGCTTTTAAT
AGTCTGGCTGCCCTTCTGTGGCCCCAATGTCATTGACCATTTAATCTGTGACCTTTTCCC
TCTGCTAAAACTCTCCTGCACTGACACTCACGTCTTCGGACTCTTTGTTGCCGCCAACAG
TGGGCTGATGTTTATGCTCATTTTTTCTATTCTTATTACCTCTTATGTCCTAATCCTCTG
CTTACTAAAGACTCACAGCACAGAAGGACAGTGGAAGGCTCTCTCTACTTGCACCTCCCA
TATCACTGTAGTCATCCTATTCTTTGTTCCCTGTATATTCATGTGCCTTTGACCCATGAT
CACCTTCCCTATTGATAAAGCTGTGTTTGTGTTTTACACTGTGGTAACACCCATGTTAAA
CCCTTTAATCTATACTCTCAGAAGCACAGAGGGGAAAAATGCCATGAAGCAGCTCTGGAG
CCAAATAATCTGGGGTAACAATTTG
Conceptual translation MEQVNNVTEF/LLGLTXTGAQKLLFAVFTLIXLTMVGNLLIVVTITTSPALHSPMYF
FLSFLSFIDGCCSSTMAPKMIFNLL/XETISFSACMTQLFAEHFFGRVEIILLVVMAY
DRYETICKPLYYLITMNRKVCGLLVAMAWAGGFLHALIQMLLIVWLPFCGPNVIDHLICD
LFPLLKLSCTDTHVFGLFVAANSGLMFMLIFSILITSYVLILCLLKTHSTEGQWKALSTC
TSHITVVILFFVPCIFMCLXMITFPIDKAVFVFYTVVTPMLNPLIYTLRSTEGKNAMKQ
LWSQIIWGNNL

Protein domains and features

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.