Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C49P Olfactory Receptor

Gene Symbol OR4C49P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.9.8P
External Ids HGNC: 31273   GeneBank: NG_004422   
Build #39 labels
Chromosomal location :- ()
Cluster
Synteny CLIC#26
Remarks no location in hg. 19

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C3 92.38% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C3 83% 301
Chimp CONTIG2000.15-9349 96% 302
Chimp CONTIG1131.66-544 91% 302
Mouse Or4c3 82% 301
Rat Or4c3 82% 301
Cow OR4C3 81% 301

Sequence information

Nucleotide sequence ATGGAAATACCACACAATATCACAGAATTTGTCATGCTGGGACTCTCACAGAACTCAGAG
GTACAGAGAGTTCTCTTTGTGGTCTTTTATGTGGTCACAGTTTGTGGCAACATGCTCATT
GTGGTCACTATCACCTCCAGCCCCACCCTGGCTTCCCCTGTGTATTTTTTCCTGGCCAAC
CTATCCTTTATTGACACCTTTTATTCTTTTTCTATGGCTCCTAAACTCATTGCTGACTCC
TTGTATGAGGGGAGAACCATTTCTTATGAGTGCTGCATGGCTCAGCTCTTTGGAGCTCAT
TTTTTGGGAGGTGTTGAGATCATTCTGCTCACACTGATGGCCTATGACCACTATGTGGCC
ATCTGTAAGCCCCTGCACTGTACTACCATCATGACCAGGCATCTCTGTGCCATGCTGGTA
GGGGTGGCTTGACTTGGGGGTTTCCTGCATTCATTGGTTCAGCTCCTCCTGGTCCTTTGG
TTGCTCTTCTGTGGGCCCAATGTGATCAATCACTTTGTCTGTGACTTGTACCCTTTGCTG
GGAGTTGGCTGCACCAACATGCATGTCATTGGTCTGCTGGTGGTTGCCAACAGTGGTTTA
ATCTGCCTGTTGAACTTCCTCATGCTGGCTGCCTCCTACATTGTCATCCTGTACTCCTTG
AGGTCCCACAGTGCAGATGGGAGACGCAAAGCCCTCTCCACCTGTGGAGCCCACTTCATT
GTTTTTGCCTTGTTCTTTGTGCCCTGTATATTTACTTATATGCTTCCATTTTCTATTTTA
TCTATAGACAAAAATATGGCATTATTTTACGGTATTCTGACACCTATGTTGAATCCGCTC
ATTTATACCCTGAGAAATGAAGAGGTAAAAAATGCCATGAGAAAGCTCTTTACATGG
Conceptual translation MEIPHNITEFVMLGLSQNSEVQRVLFVVFYVVTVCGNMLIVVTITSSPTLASPVYFFLAN
LSFIDTFYSFSMAPKLIADSLYEGRTISYECCMAQLFGAHFLGGVEIILLTLMAYDHYVA
ICKPLHCTTIMTRHLCAMLVGVAXGGFLHSLVQLLLVLWLLFCGPNVINHFVCDLYPLL
GVGCTNMHVIGLLVVANSGLICLLNFLMLAASYIVILYSLRSHSADGRRKALSTCGAHFI
VFALFFVPCIFTYMLPFSILSIDKNMALFYGILTPMLNPLIYTLRNEEVKNAMRKLFTW

Protein domains and features

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.