Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C5 Olfactory Receptor

Gene Symbol OR4C51 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.39 (functional)
Aliases OR11-99, HsOR11.8.9
External Ids HGNC: 14702   GeneBank: AB065910, BK004350, NG_002247   
Build #39 labels OR4C5P
Chromosomal location 11:48,365,488-48,366,465 (-)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C48P 85.39% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C5 80% 312
Chimp CONTIG2320.7-20962 95% 334
Mouse Or4c35 77% 301
Rat Or4c35 78% 301
Cow OR4C5P 76% 307

Sequence information

Nucleotide sequence ATGTATGTGTCAAATTGCAATCCTTGTGCTATTCACAGAAAAATCAATTATCCAAATACC
AAACTGGATTTCGAGCAAGTGAACAACATAACGGAATTCATCTTGCTTGGCCTGACACAG
AACGCAGAGGCACAGAAACTCTTGTTTGCTGTGTTTACACTCATCTACTTTCTCACCATG
GTAGACAACCTAATCATTGTGGTGACAATCACCACCAGCCCAGCCCTGGACTCCCCCGTG
TATTTTTTTCTGTCTTTCTTTTCCTTCATAGATGGCTGCTCCTCTTCTACCATGGCCCCC
AAAATGATATTTGACTTACTCACTGAAAAGAAAACTATTTCCTTCAGTGGGTGCATGACC
CAGCTCTTTGTAGAACATTTCTTTGGGGGAGTTGAGATCATTCTGCTCGTGGTGATGGCC
TATGACTGCTATGTGGCCATCTGCAAGCCCCTGTACTACCTGATCACAATGAACAGGCAG
GTATGTGGCCTCCTGGTGGCCATGGCATGGGTCGGGGGATTTCTTCACGCTCTGATTCAA
ATGCTTTTAATAGTCTGGCTGCCCTTCTGTGGCCCCAATGTCATTGACCATTTCATCTGT
GACCTTTTCCCTCTGCTAAAACTCTCCTGCACTGACACTCACGTCTTTGGACTCTTTGTT
GCCGCCAACAGTGGGCTGATGTGTATGCTCATTTTTTCTATTCTTATTACCTCTTACGTC
CTAATCCTCTGCTCACAGCGGAAGGCTCTCTCTACCTGCGCCTTCCATATCACTGTAGTC
GTCCTATTCTTTGTTCCCTGTATATTGGTGTACCTTCGACCCATGATCACCTTCCCTATT
GATAAAGCTGTGTCTGTGTTTTATACTGTGGTAACACCCATGTTAAACCCTTTAATCTAC
ACCCTCAGAAACACAGAGGTGAAAAATGCCATGAAGCAGCTCTGGAGCCAAATAATCTGG
GGTAACAATTTGTGTGAT
Conceptual translation MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFILLGLTQNAEAQKLLFAVFTLIYFLTM
VDNLIIVVTITTSPALDSPVYFFLSFFSFIDGCSSSTMAPKMIFDLLTEKKTISFSGCMT
QLFVEHFFGGVEIILLVVMAYDCYVAICKPLYYLITMNRQVCGLLVAMAWVGGFLHALIQ
MLLIVWLPFCGPNVIDHFICDLFPLLKLSCTDTHVFGLFVAANSGLMCMLIFSILITSYV
LILCSQRKALSTCAFHITVVVLFFVPCILVYLRPMITFPIDKAVSVFYTVVTPMLNPLIY
TLRNTEVKNAMKQLWSQIIWGNNLCD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 48,387,684 48,387,684 Del(1) -/T rs67755516 (DbSNP)
11 48,387,918 48,387,918 Del(1) -/T rs66829866 (DbSNP)
11 48,387,692 48,387,692 Del(1) -/T rs66509342 (DbSNP)
11 48,387,947 48,387,946 Ins(2) -/CA rs67722745 (DbSNP)
11 48,387,949 48,387,948 Ins(2) -/TA rs35173607 (DbSNP)
11 48,387,850 48,387,850 nonsense SNP G/T Y/* rs73460781 (DbSNP)
11 48,387,284 48,387,284 nonsense SNP T/G */S rs71220565 (DbSNP)
11 48,387,335 48,387,335 NS A/C F/C rs73460769 (DbSNP)
11 48,387,186 48,387,186 NS A/G F/L rs1994140 (DbSNP)
11 48,387,164 48,387,164 NS A/G F/S rs72473371 (DbSNP)
11 48,387,506 48,387,506 NS A/G V/A rs72898882 (DbSNP)
11 48,387,668 48,387,668 NS C/G G/A rs10769651 (DbSNP)
11 48,387,737 48,387,737 NS C/G C/S rs73460780 (DbSNP)
11 48,387,630 48,387,630 NS C/T G/R rs73460777 (DbSNP)
11 48,387,275 48,387,275 NS C/T R/K rs10838881 (DbSNP)
11 48,387,354 48,387,354 NS C/T A/T rs73460771 (DbSNP)
11 48,387,237 48,387,237 NS C/T V/I rs72898877 (DbSNP)
11 48,387,284 48,387,284 NS G/A S/L rs10839482 (DbSNP)
11 48,387,424 48,387,424 NS G/T F/L rs61917478 (DbSNP)
11 48,387,540 48,387,540 NS G/T Q/K rs72898885 (DbSNP)
11 48,387,705 48,387,705 NS T/C N/D rs34926479 (DbSNP)
11 48,387,155 48,387,155 NS T/C Y/C rs10839483 (DbSNP)
11 48,387,154 48,387,154 SYN A/G Y/Y rs72473370 (DbSNP)
11 48,387,370 48,387,370 SYN A/G F/F rs73460772 (DbSNP)
11 48,387,244 48,387,244 SYN A/T T/T rs7130061 (DbSNP)
11 48,387,604 48,387,604 SYN C/T V/V rs72898886 (DbSNP)
11 48,387,535 48,387,535 SYN C/T V/V rs72898883 (DbSNP)
11 48,366,116 48,366,116 NS C/G G/A 1000GP (CEU, CHBJPT)
11 48,366,408 48,366,408 NS T/C T/A 1000GP (CEU, CHBJPT)
11 48,365,954 48,365,954 NS A/G V/A 1000GP (CEU, CHBJPT)
11 48,366,095 48,366,095 NS A/G V/A 1000GP (CEU, CHBJPT)
11 48,366,185 48,366,185 NS G/C S/C 1000GP (CEU, CHBJPT)
11 48,366,135 48,366,135 NS T/C K/E 1000GP (CEU)
11 48,366,367 48,366,367 SYN G/A F/F 1000GP (CEU, CHBJPT)
11 48,366,281 48,366,281 NS T/C D/G 1000GP (CEU, CHBJPT)
11 48,366,237 48,366,237 NS C/G D/H 1000GP (CEU, CHBJPT)
11 48,365,938 48,365,938 SYN G/A H/H 1000GP (CEU, CHBJPT)
11 48,366,127 48,366,127 SYN A/G I/I 1000GP (CEU, CHBJPT)
11 48,365,988 48,365,988 NS G/T Q/K 1000GP (CEU)
11 48,366,205 48,366,205 NS A/C F/L 1000GP (CEU, CHBJPT)
11 48,366,394 48,366,394 NS G/T F/L 1000GP (CEU, CHBJPT)
11 48,366,273 48,366,273 NS T/G I/L 1000GP (CEU, CHBJPT)
11 48,365,974 48,365,974 SYN G/T L/L 1000GP (CEU, CHBJPT)
11 48,366,228 48,366,228 NS C/T V/M 1000GP (CEU, CHBJPT)
11 48,366,153 48,366,153 NS C/T D/N 1000GP (CEU, CHBJPT)
11 48,365,723 48,365,723 NS T/C K/R 1000GP (CEU, CHBJPT)
11 48,366,137 48,366,137 NS T/C K/R 1000GP (CEU, CHBJPT)
11 48,365,555 48,365,555 NS T/C N/S 1000GP (CEU, CHBJPT)
11 48,365,563 48,365,563 SYN G/A T/T 1000GP (CEU, CHBJPT)
11 48,366,378 48,366,378 NS T/C I/V 1000GP (CEU, CHBJPT)
11 48,365,983 48,365,983 SYN T/C V/V 1000GP (CEU, CHBJPT)
11 48,366,052 48,366,052 SYN C/T V/V 1000GP (CEU, CHBJPT)
11 48,365,727 48,365,727 NS G/A R/W 1000GP (CEU, CHBJPT)
11 48,365,566 48,365,566 SYN G/A Y/Y 1000GP (CEU, CHBJPT)
11 48,365,546 48,365,546 NS A/C V/G 1000GP (CHBJPT)
11 48,365,685 48,365,685 NS C/T V/I 1000GP (CHBJPT)
11 48,365,686 48,365,686 SYN G/A V/V 1000GP (CHBJPT)
11 48,365,732 48,365,732 nonsense SNP G/C S/* 1000GP (CHBJPT)
11 48,365,749 48,365,749 SYN G/A Y/Y 1000GP (CHBJPT)
11 48,365,783 48,365,783 NS C/A C/F 1000GP (CHBJPT)
11 48,366,078 48,366,078 NS C/T G/R 1000GP (CHBJPT)
11 48,366,338 48,366,338 NS T/C E/G 1000GP (CHBJPT)
11 48,366,342 48,366,342 NS C/T A/T 1000GP (CHBJPT)
11 48,366,348 48,366,348 nonsense SNP G/A Q/* 1000GP (CHBJPT)
11 48,366,426 48,366,426 nonsense SNP T/A K/* 1000GP (CHBJPT)
11 48,366,431 48,366,431 NS T/C H/R 1000GP (CHBJPT)
11 100 -100 NS A/C V/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A T/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 nonsense SNP G/T Y/* 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
CopyNumber 34 (Hasin)
11 48,385,040 48,388,117 CopyNumber #176 (Waszak)
11 48,387,127 48,387,354 Ins(16) #6(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F278L L269F V145E C143Y G117A D77H I55V A42T Q40* T20A % Freq CORP
1 F L V C G D I A Q T 11.83 0.674
2 L L V C G D I A Q T 7.91 0.674
3 F L V C G H I A Q T 6.91 0.674
4 L L V C G H I A Q T 6.45 0.674
5 F F V C G H I A Q T 3.61 0.674
6 F F V C G D I A Q T 3.53 0.674
7 L L V C G D I T * A 3.00 1.200
8 L L V C G H I T * A 2.92 1.200
9 F L V C A D I A Q T 2.92 0.674
10 F L V C A H I A Q T 2.92 0.674
11 F L V C G H I T * A 2.46 1.200
12 F L V C G D I T * A 2.23 1.200
13 F F V C G D I T * A 1.54 1.200
14 F F E C A H I A Q T 1.38 0.674
15 F L V C G H I A Q A 1.38 0.674
16 F F V C G H I T * A 1.31 1.200
17 F L V C G D I T * T 1.23 1.200
18 F F V C A D I A Q T 1.23 0.674
19 F L V C G D I A Q A 1.23 0.674
20 F L V C A D I T * A 1.15 1.200
21 F F V C A H I A Q T 1.08 0.674
22 F F V C G H I T * T 1.00 1.200
23 L L V C G H I T * T 0.92 1.200
24 L L V C G D I T * T 0.92 1.200
25 F L V C A D I A Q A 0.92 0.674
26 F F E C G D I A Q T 0.92 0.674
27 F L V C G H I T * T 0.92 1.200
28 F L V C A H I T * A 0.92 1.200
29 L L V C G D I A Q A 0.84 0.674
30 F F E C G D I T * A 0.84 1.200
31 F F V C G H I A Q A 0.84 0.674
32 F L E C G D I A Q T 0.84 0.674
33 F F E C A D I T * A 0.77 1.200
34 F F V C A D I T * A 0.77 1.200
35 F F V C G D I A Q A 0.69 0.674
36 F F V C A H I T * A 0.69 1.200
37 L L V C A D I A Q T 0.69 0.674
38 F F E C G H I A Q T 0.69 0.674
39 F F E C A D I A Q T 0.61 0.674
40 L L V C A H I T * A 0.61 1.200
41 L L V C G H I A Q A 0.61 0.674
42 F L E C G H I A Q T 0.54 0.674
43 F F E C A H I T * A 0.54 1.200
44 L L V C A H I A Q T 0.54 0.674
45 L F V C G D I T * T 0.46 1.200
46 F F E C G H I T * A 0.46 1.200
47 F L E C G D I A Q A 0.46 0.674
48 F L V C G D V A Q T 0.46 0.674
49 F L V C A H I A Q A 0.38 0.674
50 L F V C G D I A Q T 0.38 0.674
51 F L E C A H I A Q T 0.38 0.674
52 F L V C G D I T Q T 0.38 0.674
53 F L E C A D I T * A 0.31 1.200
54 F L V C A H I T * T 0.31 1.200
55 F L E C A H I T * A 0.31 1.200
56 F F E C G H I T * T 0.31 1.200
57 L L E C G D I A Q T 0.31 0.674
58 L F V C G H I A Q T 0.31 0.674
59 F F V C G D I T * T 0.31 1.200
60 F L E C G H I T * A 0.31 1.200
61 F L V C A D I T * T 0.31 1.200
62 L F E C G H I A Q T 0.31 0.674
63 L F V C G H I T * A 0.23 1.200
64 F F V C A D V A Q T 0.23 0.674
65 L L V C A D I T * A 0.23 1.200
66 L L V C A D I A Q A 0.23 0.674
67 F F V C A H I A Q A 0.23 0.674
68 L F V C G H I A Q A 0.23 0.674
69 L L V C A H I A Q A 0.15 0.674
70 F F V C A H I T * T 0.15 1.200
71 F L E C A D I A Q T 0.15 0.674
72 L L E C G D I T * T 0.15 1.200
73 L F V C A D I A Q T 0.15 0.674
74 L L V C A H I T * T 0.15 1.200
75 L L E C G H I A Q T 0.15 0.674
76 F L E C G H I T * T 0.15 1.200
77 F F V C G H I T Q T 0.15 0.674
78 L F V C G D I A Q A 0.15 0.674
79 L L V C G D I T Q T 0.15 0.674
80 L F V C A H I T * T 0.15 1.200
81 L L V C A D I T * T 0.15 1.200
82 L L E C G H I A Q A 0.15 0.674
83 F F E C A H I A Q A 0.15 0.674
84 L L E C G D I A Q A 0.15 0.674
85 L L V C G H I T Q T 0.15 0.674
86 F F V C G H V A Q T 0.15 0.674
87 F L V C G H V A Q T 0.15 0.674
88 L L V Y G H I A Q T 0.15 0.674
89 F L E C G H V A Q T 0.08 0.674
90 F L E C A D I T Q T 0.08 0.674
91 L L V Y A D I T * A 0.08 1.200
92 F F V C G D I T Q T 0.08 0.674
93 L F V Y G D I T * T 0.08 1.200
94 F L E C A D I A Q A 0.08 0.674
95 L F V C A H I T * A 0.08 1.200
96 F L V C G H I T Q T 0.08 0.674
97 F L V C G D I T Q A 0.08 0.674
98 F F V C A D I T * T 0.08 1.200
99 F F E C A D I T * T 0.08 1.200
100 F L E C G H I A Q A 0.08 0.674
101 L F E C G D I T * T 0.08 1.200
102 L F V C A H I A Q A 0.08 0.674
103 F L V Y G D I A Q T 0.08 0.674
104 L L V C A D I T Q T 0.08 0.674
105 F F V C A H V A Q T 0.08 0.674
106 F F E C A H I T Q T 0.08 0.674
107 F L V Y G D I A Q A 0.08 0.674
108 F L V Y G H I A Q A 0.08 0.674
109 F L E C G D I T * A 0.08 1.200
110 L F V Y G H I T * A 0.08 1.200
111 F F V Y G H I T * T 0.08 1.200
112 L F V C A D I T * T 0.08 1.200
113 L L E C A H I A Q A 0.08 0.674
114 L L V C G H V A Q T 0.08 0.674
115 F L V C G D I A * A 0.08 1.200
116 L L V C G D V A Q T 0.08 0.674
117 F F V C A H I A * A 0.08 1.200
118 L L E C A H I T * A 0.08 1.200
119 L L V Y G H I T * T 0.08 1.200
120 F L V Y G H I A Q T 0.08 0.674
121 F L V C G H I A * A 0.08 1.200
122 F L E C G D I T Q A 0.08 0.674
123 F F V Y G D I T * T 0.08 1.200
124 L L E C G H I T * T 0.08 1.200
125 L L E C G D I T * A 0.08 1.200
126 L L V C A D V A Q T 0.08 0.674
127 F L V C A D V A Q T 0.08 0.674
128 L F V C A D I A Q A 0.08 0.674
129 F F E C A H I T * T 0.08 1.200
130 L F V C A H I A Q T 0.08 0.674