Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C50P Olfactory Receptor

Gene Symbol OR4C50P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.10.9P
External Ids HGNC: 31274   GeneBank: NG_004295   
Build #39 labels
Chromosomal location 11:54,591,479-54,592,405 (-)
Cluster 11@51
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C12 86.08% 309
OR4C2P 90.29% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C12 84% 309
Dog OR4C12C 82% 309
Chimp CONTIG2320.6-3538 91% 309
Chimp CONTIG2000.4-9035 86% 309
Mouse Or4c12 81% 309
Mouse Or4c12b 81% 304
Rat Or4c12 81% 303
Cow OR4C12 81% 309
Cow OR4C12DP 80% 276

Sequence information

Nucleotide sequence ATGAAGAATAAAAGGAATGTGACTGAATTCATTTTAACAGGTCTTACACAGAACCCTAAA
ATGGAGAAAATCATGTTTGCAGTATTTTTGGTTCCTTACATGATAACACTTTCAGGCAAC
CTGCTCATTGTGGTTACAATTACCACCAGCCAGGCTCTGATCTCCCCCATGTACTTCTTC
CTGACCCACCTTTCTTTGATAGACACAGTTTATTCTTCTTCTTCAGCTCCTAAGTTGATT
GCCGATTCCCTTCATGAGAAGAAAATCATCTCCTTTAATGGGTGTATGGCTCAAGCCTAT
GCAGAACACATTTTTGGTGCTACTGAGATCATCCTGCTGACAGTGATGGCCTGTGACCAC
AATGTGGCCATCTGCAAACCTCTGCACTACACAACCATCATGAGCCAAAGCCTGTGCATT
CTCCTAGCGGTAGTGGCCTGGATGGGAGGATTTCTCCATGCAACTATTCAGATTCTCTTT
ACAGTATGGCTGCCCTTCTGTGGCCCCAATGTAATAGACCACTTCATGTGTGACTTGTAC
CCTTTGTTAAAACTTGTTTGCCTGGACACTCACACCCTTGGTTTCTTTGTTGCTGCCAAC
AGTGGGTTCATCTGCCTATTAAACTTCCTTCTCTAGATGGTATCCTGTGTGATCATCTTG
AGATCTTTAAAGAACTATAGCTTGGAGGGGAAGGGTAAAGCCCTCTCCACCTGTATTTCT
CACATCATAGTAATTGTCTTATTCTTTGTGCCCTGTATATTTGTGTATCTGTGCCCAGTG
ACCACTCTGCACATTGAAAAAGCTGCTGCTGTATTTTATACTATGGTGGTCCCAATGTTA
AATCCTTTGATCTACACACTCAGAAATGCTGAGTTAAAAAGTGTGATAAGGAAGCTTTGG
AGAAAAAAAGTGATTTCAGATAATAAT
Conceptual translation MKNKRNVTEFILTGLTQNPKMEKIMFAVFLVPYMITLSGNLLIVVTITTSQALISPMYFF
LTHLSLIDTVYSSSSAPKLIADSLHEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDH
NVAICKPLHYTTIMSQSLCILLAVVAWMGGFLHATIQILFTVWLPFCGPNVIDHFMCDLY
PLLKLVCLDTHTLGFFVAANSGFICLLNFLLXVSCVIILRSLKNYSLEGKGKALSTCIS
HIIVIVLFFVPCIFVYLCPVTTLHIEKAAAVFYTMVVPMLNPLIYTLRNAELKSVIRKLW
RKKVISDNN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 51,527,526 51,527,525 Ins(1) -/A rs72056292 (DbSNP)
11 51,526,957 51,526,957 SNP A/G rs11246617 (DbSNP)
11 51,527,218 51,527,218 SNP A/G rs11246618 (DbSNP)
11 51,527,239 51,527,239 SNP A/G rs12421819 (DbSNP)
11 51,527,345 51,527,345 SNP A/G rs56219368 (DbSNP)
11 51,527,281 51,527,281 SNP C/G rs11607644 (DbSNP)
11 51,527,387 51,527,387 SNP C/G rs55899978 (DbSNP)
11 51,527,111 51,527,111 SNP C/T rs61004621 (DbSNP)
11 51,527,695 51,527,695 SNP C/T rs56244707 (DbSNP)
11 51,527,010 51,527,010 SNP G/T rs10902366 (DbSNP)
11 51,527,482 51,527,482 SNP T/C rs35049610 (DbSNP)
11 54,592,368 54,592,368 SNP C/T 1000GP (CEU, CHBJPT)
11 54,592,269 54,592,269 SNP T/G 1000GP (CEU, CHBJPT)
11 54,592,168 54,592,168 SNP C/T 1000GP (CEU)
11 54,592,061 54,592,061 SNP A/G 1000GP (CEU)
11 54,592,040 54,592,040 SNP G/A 1000GP (CEU)
11 54,591,998 54,591,998 SNP G/C 1000GP (CEU, CHBJPT)
11 54,591,934 54,591,934 SNP G/A 1000GP (CEU)
11 54,591,892 54,591,892 SNP C/G 1000GP (CEU)
11 54,591,642 54,591,642 SNP G/A 1000GP (CEU)
11 54,591,584 54,591,584 SNP T/C 1000GP (CEU)
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 51,192,824 51,563,636 CopyNumber Variation_8689 (DGV)
11 51,372,036 51,529,002 CopyNumber Variation_53111 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.