Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C6 Olfactory Receptor

Gene Symbol OR4C61 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-138, HsOR11.11.20, ORL3425
External Ids HGNC: 14743   GeneBank: AB065517, BK004330, CR593785, NM_001004704   ORDB: ORL3425   
Build #39 labels OR4C6
Chromosomal location 11:55,665,167-55,666,093 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C14P 69.26% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C6 81% 309
Chimp CONTIG10409.3-1803 98% 309
Mouse Or4c102 78% 302
Rat Or4c102 77% 302
Cow OR4C163P 68% 313

Expression evidences

Source Accession
ESTs BX330269
mRNA AB463962

Sequence information

Nucleotide sequence ATGGAAAATCAAAACAATGTGACTGAATTCATTCTTCTGGGTCTCACAGAGAACCTGGAG
CTGTGGAAAATATTTTCTGCTGTGTTTCTTGTCATGTATGTAGCCACAGTGCTGGAAAAT
CTACTTATTGTGGTAACTATTATCACAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTT
CTTACCTTCTTGTCCCTTTTGGATGTCATGTTCTCATCTGTCGTTGCCCCCAAGGTGATT
GTAGACACCCTCTCCAAGAGCACTACCATCTCTCTCAAAGGCTGCCTCACCCAGCTGTTT
GTGGAGCATTTCTTTGGTGGTGTGGGGATCATCCTCCTCACTGTGATGGCCTATGACCGC
TACGTGGCCATCTGTAAGCCCCTGCACTACACGATCATCATGAGTCCACGGGTGTGCTGC
CTAATGGTAGGAGGGGCTTGGGTGGGGGGATTTATGCACGCAATGATACAACTTCTCTTC
ATGTATCAAATACCCTTCTGTGGTCCTAATATCATAGATCACTTTATATGTGATTTGTTT
CAGTTGTTGACACTTGCCTGCACGGACACCCACATCCTGGGCCTCTTAGTTACCCTCAAC
AGTGGGATGATGTGTGTGGCCATCTTTCTTATCTTAATTGCGTCCTACACGGTCATCCTA
TGCTCCCTGAAGTCTTACAGCTCTAAAGGGCGGCACAAAGCCCTCTCTACCTGCAGCTCC
CACCTCACGGTGGTTGTATTGTTCTTTGTCCCCTGTATTTTCTTGTACATGAGGCCTGTG
GTCACTCACCCCATAGACAAGGCAATGGCTGTGTCAGACTCAATCATCACACCCATGTTA
AATCCCTTGATCTATACACTGAGGAATGCAGAGGTGAAAAGTGCCATGAAGAAACTCTGG
ATGAAATGGGAGGCTTTGGCTGGGAAA
Conceptual translation MENQNNVTEFILLGLTENLELWKIFSAVFLVMYVATVLENLLIVVTIITSQSLRSPMYFF
LTFLSLLDVMFSSVVAPKVIVDTLSKSTTISLKGCLTQLFVEHFFGGVGIILLTVMAYDR
YVAICKPLHYTIIMSPRVCCLMVGGAWVGGFMHAMIQLLFMYQIPFCGPNIIDHFICDLF
QLLTLACTDTHILGLLVTLNSGMMCVAIFLILIASYTVILCSLKSYSSKGRHKALSTCSS
HLTVVVLFFVPCIFLYMRPVVTHPIDKAMAVSDSIITPMLNPLIYTLRNAEVKSAMKKLW
MKWEALAGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,432,668 55,432,668 NS A/C E/A rs61729625 (DbSNP)
11 55,433,505 55,433,505 NS A/G K/R rs12363829 (DbSNP)
11 55,433,040 55,433,040 NS C/T T/I rs11230600 (DbSNP)
11 55,432,876 55,432,876 SYN A/G K/K rs61995720 (DbSNP)
11 55,432,930 55,432,930 SYN C/G L/L rs61995737 (DbSNP)
11 55,665,917 55,665,917 NS C/T P/S 1000GP (CEU)
11 55,665,564 55,665,564 NS T/C I/T 1000GP (CEU, CHBJPT)
11 55,665,914 55,665,914 NS G/T V/F 1000GP (CHBJPT)
11 100 -100 SYN C/T T/T 1000GP (YRI)
11 100 -100 NS T/C I/T 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,359,025 55,470,359 CopyNumber Variation_0419 (DGV), Variation_34977 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,382,681 55,548,038 CopyNumber Variation_4743 (DGV)
11 55,367,167 55,452,993 CopyNumber Variation_6923 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,360,213 55,447,427 CopyNumber Variation_9663 (DGV), Variation_48827 (DGV)
11 55,371,021 55,447,427 CopyNumber Variation_10359 (DGV), Variation_48834 (DGV), Variation_48835 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,360,213 55,447,426 CopyNumber Variation_29606 (DGV)
11 55,371,020 55,460,788 CopyNumber Variation_29910 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,367,884 55,459,183 CopyNumber Variation_31823 (DGV)
11 55,362,651 55,460,561 CopyNumber Variation_34978 (DGV)
11 55,432,955 55,495,323 Inversion Variation_37124 (DGV)
11 55,358,496 55,434,466 CopyNumber Variation_37484 (DGV)
11 55,374,032 55,453,009 CopyNumber Variation_38079 (DGV)
11 55,368,154 55,450,788 CopyNumber Variation_38972 (DGV)
11 55,335,878 55,453,486 CopyNumber Variation_48051 (DGV)
11 55,381,588 55,474,194 CopyNumber Variation_48053 (DGV)
11 55,422,490 55,475,200 CopyNumber Variation_48055 (DGV)
11 55,360,213 55,442,368 CopyNumber Variation_48826 (DGV)
11 55,360,213 55,470,003 CopyNumber Variation_48828 (DGV)
11 55,371,021 55,437,126 CopyNumber Variation_48832 (DGV)
11 55,371,021 55,442,368 CopyNumber Variation_48833 (DGV)
11 55,371,021 55,460,095 CopyNumber Variation_48836 (DGV)
11 55,383,157 55,447,427 CopyNumber Variation_48837 (DGV), Variation_53573 (DGV)
11 55,396,041 55,442,368 CopyNumber Variation_48839 (DGV)
11 55,339,829 55,447,427 CopyNumber Variation_53140 (DGV)
11 55,408,664 55,447,427 CopyNumber Variation_53178 (DGV)
11 55,360,213 55,490,377 CopyNumber Variation_53507 (DGV)
11 55,360,213 55,460,788 CopyNumber Variation_53994 (DGV)
11 55,360,213 55,470,994 CopyNumber Variation_54018 (DGV)
11 55,364,677 55,453,061 CopyNumber Variation_65955 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,366,131 55,452,023 CopyNumber Variation_75644 (DGV)
11 55,421,049 55,452,023 CopyNumber Variation_75645 (DGV)
11 55,422,701 55,509,962 CopyNumber Variation_85778 (DGV)
11 55,365,707 55,452,023 CopyNumber Variation_85779 (DGV)
Deletion 255 (Hasin)
11 55,432,543 55,435,569 Deletion #310 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L112V I133T A154T I208M R231W % Freq CORP
1 L I A I R 71.97 0.044
2 L T A I R 25.73 0.044
3 L I T I R 1.38 0.044
4 V I A I R 0.31 0.044
5 L I A I W 0.23 0.037
6 L I A M R 0.15 0.044
7 V T A I R 0.15 0.044
8 L T A M R 0.08 0.044

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C6.aApr07 exon_5UTR chr11 55,658,268 55,658,392 +
exon_5UTR chr11 55,662,151 55,662,248 +
main_exon 5UTR chr11 55,665,125 55,665,167 +
CDS chr11 55,665,167 55,666,093 +
3UTR chr11 55,666,093 55,666,686 +